| Cat.No.: | PE-0805 |
| Product Name: | Recombinant Human ETS1 |
| Product Overview: | Recombinant full length Human ETS1 with N terminal proprietary tag; Predicted MWt 74.58 kDa. |
| Description: | This gene encodes a member of the ETS family of transcription factors, which are defined by the presence of a conserved ETS DNA-binding domain that recognizes the core consensus DNA sequence GGAA/T in target genes. These proteins function either as transcriptional activators or repressors of numerous genes, and are involved in stem cell development, cell senescence and death, and tumorigenesis. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Molecular Weight: | 74.580kDa inclusive of tags |
| Species: | Human |
| Amino Acid Sequence: | MKAAVDLKPTLTIIKTEKVDLELFPSPDMECADVPLLTPS SKEMMSQALKATFSGFTKEQQRLGIPKDPRQWTETHVRDW VMWAVNEFSLKGVDFQKFCMNGAALCALGKDCFLELAPDF VGDILWEHLEILQKEDVKPYQVNGVNPAYPESRYTSDYFI SYGIEHAQCVPPSEFSEPSFITESYQTLHPISSEELLSLK YENDYPSVILRDPLQTDTLQNDYFAIKQEVVTPDNMCMGR TSRGKLGGQDSFESIESYDSCDRLTQSWSSQSSFNSLQRV PSYDSFDSEDYPAALPNHKPKGTFKDYVRDRADLNKDKPV IPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDG WEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKN IIHKTAGKRYVYRFVCDLQSLLGYTPEELHAMLDVKPDAD E |
| Sequence Similarities: | Belongs to the ETS family.Contains 1 ETS DNA-binding domain.Contains 1 PNT (pointed) domain. |
| Expression System: | Wheat germ |
| Protein Length: | 441 amino acids |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Gene Name: | ETS1 v-ets erythroblastosis virus E26 oncogene homolog 1 (avian) [ Homo sapiens ] |
| Gene ID NCBI: | 2113 |
| Official Symbol: | ETS1 |
| Synonyms: | ETS1; v-ets erythroblastosis virus E26 oncogene homolog 1 (avian); EWSR2, v ets avian erythroblastosis virus E26 oncogene homolog 1; protein C-ets-1; Avian erythroblastosis virus E26 (v ets) oncogene homolog 1; ets protein; ETS 1; FLJ10768; |
| mRNA Refseq: | NM_001143820 |
| Protein Refseq: | NP_001137292 |
| MIM: | 164720 |
| UniProt ID: | P14921 |
| Chromosome Location: | 11q23.3 |
| Function: | DNA binding; protein binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; sequence-specific DNA binding transcription factor activity; |
| Product Types | ||
| ◆ Extracts & Lysates | ||
| EL-0105 | Recombinant Human ETS1 293 Cell Lysate | Inquiry |
| ◆ Antibodies | ||
| EAb-0139 | ETO Polyclonal Antibody | Inquiry |
| EAb-0195 | ERM/ ETV5 Polyclonal Antibody | Inquiry |
| ◆ Proteins & Enzymes | ||
| PE-0804 | Recombinant Human ETS1 | Inquiry |
| PE-0805 | Recombinant Human ETS1 | Inquiry |
| Related Gene / Proteins | |||
| ETO | ETR3 | ETS1 | ETV5 |
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools
