| Cat.No.: | PE-1027 |
| Product Name: | Recombinant Human ANKRD1 protein, T7/His-tagged |
| Product Overview: | Recombinant human ANKRD1 cDNA (2–319 aa) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli. |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Purity: | >90% by SDS-PAGE |
| Species: | Human |
| Formulation: | 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Sucrose. |
| Tag: | T7/His |
| Amino Acid Sequence: | MASMTGGQQMGRGHHHHHHENLYFQGGEFMVLKVEELVTGKKNGNGEAGEFLPEDFRDGEYEAAVTLEKQEDLKT LLAHPVTLGEQQWKSEKQREAELKKKKLEQRSKLENLEDLEIIIQLKKRKKYRKTKVPVVKEPEPEIITEPVDVP TFLKAALENKLPVVEKFLSDKNNPDVCDEYKRTALHRACLEGHLAIVEKLMEAGAQIEFRDMLESTAIHWASRGG NLDVLKLLLNKGAKISARDKLLSTALHVAVRTGHYECAEHLIACEADLNAKDREGDTPLHDAVRLNRYKMIRLLI MYGADLNIKNCAGKTPMDLVLHWQNGTKAIFDSLRENSYKTSRIATF |
| Expression System: | E. coli |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Gene Name: | ANKRD1 ankyrin repeat domain 1 (cardiac muscle) [ Homo sapiens ] |
| Gene ID NCBI: | 27063 |
| Official Symbol: | ANKRD1 |
| Synonyms: | ANKRD1; ankyrin repeat domain 1 (cardiac muscle); ankyrin repeat domain-containing protein 1; ALRP; C 193; CARP; CVARP; MCARP; liver ankyrin repeat domain 1; cardiac ankyrin repeat protein; cytokine-inducible nuclear protein; cytokine-inducible gene C-193 protein; C-193; bA320F15.2; |
| mRNA Refseq: | NM_014391 |
| Protein Refseq: | NP_055206 |
| MIM: | 609599 |
| UniProt ID: | Q15327 |
| Chromosome Location: | 10q23.33 |
| Function: | DNA binding; R-SMAD binding; RNA polymerase II transcription coactivator activity; RNA polymerase II transcription factor binding; histone deacetylase binding; p53 binding; protein binding; titin binding; transcription corepressor activity; |
| Product Types | ||
| ◆ Antibodies | ||
| EAb-0057 | Phospho-ANAPC1 (Ser688) Polyclonal Antibody | Inquiry |
| ◆ Extracts & Lysates | ||
| EL-0131 | Recombinant Human ANKRD1 293 Cell Lysate | Inquiry |
| EL-0228 | Recombinant Human ANKRA2 293 Cell Lysate | Inquiry |
| ◆ Proteins & Enzymes | ||
| PE-1023 | Recombinant Human Ankyrin Repeat Domain 1 (Cardiac Muscle), His-tagged | Inquiry |
| PE-1024 | Recombinant Human ANKRD1, GST-tagged | Inquiry |
| Related Gene / Proteins | |||
| ANAPC1 | Androgen Receptor | ANKRA2 | ANKRD1 |
| ANKRD17 | ANO9A | ||
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools
