| Cat.No.: | PE-2087 |
| Product Name: | Recombinant Human p400 protein |
| Background: | Component of the NuA4 histone acetyltransferase complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histones H4 and H2A. This modification may both alter nucleosome - DNA interactions and promote interaction of the modified histones with other proteins which positively regulate transcription. May be required for transcriptional activation of E2F1 and MYC target genes during cellular proliferation. The NuA4 complex ATPase and helicase activities seem to be, at least in part, contributed by the association of RUVBL1 and RUVBL2 with EP400. May regulate ZNF42 transcription activity. |
| Applications: | Western blot; ELISA |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Species: | Human |
| Formulation: | pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl |
| Alternative Names: | CAG repeat protein 32/CAGH 32/CAGH32 |
| Tag: | GST |
| Amino Acid Sequence: | QVHQRIAELRKAGLWSQRRLPKLQEAPRPKSHWDYLLEEMQWMATDFAQE RRWKVAAAKKLVRTVVRHHEEKQLREERGKKEEQSRLRRIAASTAREIEC FWSNIEQV |
| Sequence Similarities: | Belongs to the SNF2/RAD54 helicase family. SWR1 subfamily.Contains 1 helicase ATP-binding domain.Contains 1 helicase C-terminal domain.Contains 1 HSA domain.Contains 1 Myb-like domain. |
| Expression System: | Wheat germ |
| Protein Length: | Protein fragment; 743 to 850 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Product Types | ||
| ◆ Proteins & Enzymes | ||
| PE-2087 | Recombinant Human p400 protein | Inquiry |
| ◆ Antibodies | ||
| EAb-2476 | p400 Polyclonal Antibody | Inquiry |
| EAb-2731 | p400 Polyclonal Antibody | Inquiry |
| Related Gene / Proteins | |||
| p400 | |||
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools
