| Cat.No.: | PE-2491 |
| Product Name: | Recombinant Human MCM8 protein |
| Background: | Component of the MCM8-MCM9 complex, a complex involved in homologous recombination repair following DNA interstrand cross-links and plays a key role during gametogenesis. The MCM8-MCM9 complex probably acts as a hexameric helicase downstream of the Fanconi anemia proteins BRCA2 and RAD51 and is required to process aberrant forks into homologous recombination substrates and to orchestrate homologous recombination with resection, fork stabilization and fork restart. May also play a non-essential for DNA replication: may be involved in the activation of the prereplicative complex (pre-RC) during G(1) phase by recruiting CDC6 to the origin recognition complex (ORC). Binds chromatin throughout the cell cycle. |
| Applications: | ELISA; Western blot |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Species: | Human |
| Formulation: | pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl |
| Alternative Names: | C20orf154/dJ967N21.5/DNA helicase MCM8 |
| Tag: | GST |
| Amino Acid Sequence: | TYSDEFGNLDFERSQHGSGMSNRSTAKRFISALNNVAERTYNNIFQFHQL RQIAKELNIQVADFENFIGSLNDQGYLLKKGPKVYQLQTM |
| Sequence Similarities: | Belongs to the MCM family.Contains 1 MCM domain. |
| Expression System: | Wheat germ |
| Protein Length: | Protein fragment; 646 to 735 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Product Types | ||
| ◆ Cell Lines | ||
| CL-0011 | Human MCF2L Knockout Cell Line | Inquiry |
| ◆ Antibodies | ||
| EAb-0068 | MCAF Polyclonal Antibody | Inquiry |
| EAb-0303 | MCM6 Polyclonal Antibody | Inquiry |
| ◆ Extracts & Lysates | ||
| EL-0161 | Recombinant Human MCRS1 293 Cell Lysate | Inquiry |
| ◆ Proteins & Enzymes | ||
| PE-1225 | Recombinant Human MCRS1, His-tagged | Inquiry |
| Related Gene / Proteins | |||
| MCAF1 | MCF2L | MCM6 | MCM8 |
| MCRS1 | |||
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools
