| Cat.No.: | PE-1225 |
| Product Name: | Recombinant Human MCRS1, His-tagged |
| Product Overview: | Recombinant fragment, corresponding to amino acids 14-317 of Human MCRS1 with N terminal His tag; MWt 35 kDa. |
| Description: | MCRS1 (Microspherule protein 1) modulates the transcription repressor activity of DAXX by recruiting it to the nucleolus. It also associates with TERT and inhibits telomerase activity. |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Species: | Human |
| Formulation: | Lyophilised:Reconstitute with 61 μl aqua dest. |
| Tag: | His |
| Amino Acid Sequence: | MASGTASRSEDEESLAGQKRASSQALGTIPKRRSSSRFIK RKKFDDELVESSLAKSSTRAKGASGVEPGRCSGSEPSS SEKKKVSKAPSTPVPPSPAPAPGLTKRVKKSKQPLQVT KDLGRWKPADDLLLINAVLQTNDLTSVHLGVKFSCRFT LREVQERWYALLYDPVISKLACQAMRQLHPEAIAAIQSKA LFSKAEEQLLSKVGSTSQPTLETFQDLLHRHPDAFYLA RTAKALQAHWQLMKQYYLLEDQTVQPLPKGDQVLNFSD AEDLIDDSKLKDMRDEVLEHELMVADRRQKREIR |
| Expression System: | E. coli |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Gene Name: | MCRS1 microspherule protein 1 [ Homo sapiens ] |
| Gene ID NCBI: | 10445 |
| Official Symbol: | MCRS1 |
| Synonyms: | MCRS1; microspherule protein 1; ICP22BP; INO80 complex subunit Q; INO80Q; MCRS2; MSP58; P78; |
| mRNA Refseq: | NM_001012300 |
| Protein Refseq: | NP_001012300 |
| MIM: | 609504 |
| UniProt ID: | Q96EZ8 |
| Chromosome Location: | 12q13.12 |
| Function: | protein binding; |
| Product Types | ||
| ◆ Cell Lines | ||
| CL-0011 | Human MCF2L Knockout Cell Line | Inquiry |
| ◆ Antibodies | ||
| EAb-0068 | MCAF Polyclonal Antibody | Inquiry |
| EAb-0303 | MCM6 Polyclonal Antibody | Inquiry |
| ◆ Extracts & Lysates | ||
| EL-0161 | Recombinant Human MCRS1 293 Cell Lysate | Inquiry |
| ◆ Proteins & Enzymes | ||
| PE-1225 | Recombinant Human MCRS1, His-tagged | Inquiry |
| Related Gene / Proteins | |||
| MCAF1 | MCF2L | MCM6 | MCM8 |
| MCRS1 | |||
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools
