Recombinant Human MBD1 protein


  • Specification
  • Related Products
Cat.No.:  PE-2956
Product Name:  Recombinant Human MBD1 protein
Background:  Transcriptional repressor that binds CpG islands in promoters where the DNA is methylated at position 5 of cytosine within CpG dinucleotides. Binding is abolished by the presence of 7-mG that is produced by DNA damage by methylmethanesulfonate (MMS). Acts as transcriptional repressor and plays a role in gene silencing by recruiting AFT7IP, which in turn recruits factors such as the histone methyltransferase SETDB1. Probably forms a complex with SETDB1 and ATF7IP that represses transcription and couples DNA methylation and histone 'Lys-9' trimethylation. Isoform 1 and isoform 2 can also repress transcription from unmethylated promoters.
Applications:  ELISA; SDS-PAGE; Western blot
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Molecular Weight:  36 kDa including tags
Species:  Human
Formulation:  pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl
Accession#:  Q9UIS9
Alternative Names:  CXXC 3/CXXC-type zinc finger protein 3/CXXC3
Amino Acid Sequence:  HHLGPTLKPTLATRTAQPDHTQAPTKQEAGGGFVLPPPGTDLVFLREGAS SPVQVPGPVAASTEALLQEAQCSGLSWVVALPQVKQEKADTQDE
Sequence Similarities:  Contains 3 CXXC-type zinc fingers.Contains 1 MBD (methyl-CpG-binding) domain.
Expression System:  Wheat germ
Post Translational Modifications:  Sumoylated with SUMO1 by PIAS1 and PIAS3. Sumoylation affects transcriptional silencing by preventing the interaction with SETDB1. In contrast, sumoylation may increase interaction with AFT7IP.Phosphorylated upon DNA damage, probably by ATM or ATR.
Protein Length:  Protein fragment; 415 to 508
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Follow us on

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.