p400 Polyclonal Antibody


  • Specification
  • Target Information
  • Related Products
Cat.No.:  EAb-2731
Product Name:  p400 Polyclonal Antibody
Product Overview:  Rabbit polyclonal to detect p400
Antibody Type:  Polyclonal
Immunogen:  Recombinant fragment corresponding to Human p400 aa 946-1086.
Immunogen Sequence:  DDEVDDEEETIEEEEANEGVVDHQTELSNLAKEAELPLLDLMKLYEGAFL PSSQWPRPKPDGEDTSGEEDADDCPGDRESRKDLVLIDSLFIMDQFKAAE RMNIGKPNAKDIADVTAVAEAILPKGSARVTTSVKFNAPSL
Host:  Rabbit
Isotype:  IgG
Purification:  Immunogen affinity purified
Appearance:  Liquid
Formulation:  pH: 7.20; 0.02% Sodium azide, PBS, 40% Glycerol
Applications:  IHC-P, ICC/IF
Species Reactivity:  Human
Storage:  -20°C.
Warning:  For Research Use Only! Not For Use in Humans.
Accession:  Q96L91
Alternative Name:  CAG repeat protein 32 antibody/CAGH 32 antibody/CAGH32 antibody
Scientific Background:  Component of the NuA4 histone acetyltransferase complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histones H4 and H2A. This modification may both alter nucleosome - DNA interactions and promote interaction of the modified histones with other proteins which positively regulate transcription. May be required for transcriptional activation of E2F1 and MYC target genes during cellular proliferation. The NuA4 complex ATPase and helicase activities seem to be, at least in part, contributed by the association of RUVBL1 and RUVBL2 with EP400. May regulate ZNF42 transcription activity.
Product Types
◆ Proteins & Enzymes
PE-2087 Recombinant Human p400 protein Inquiry
◆ Antibodies
EAb-2476 p400 Polyclonal Antibody Inquiry
EAb-2731 p400 Polyclonal Antibody Inquiry
Related Gene / Proteins
p400

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Follow us on

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.