| Cat.No.: | EAb-2731 |
| Product Name: | p400 Polyclonal Antibody |
| Product Overview: | Rabbit polyclonal to detect p400 |
| Antibody Type: | Polyclonal |
| Immunogen: | Recombinant fragment corresponding to Human p400 aa 946-1086. |
| Immunogen Sequence: | DDEVDDEEETIEEEEANEGVVDHQTELSNLAKEAELPLLDLMKLYEGAFL PSSQWPRPKPDGEDTSGEEDADDCPGDRESRKDLVLIDSLFIMDQFKAAE RMNIGKPNAKDIADVTAVAEAILPKGSARVTTSVKFNAPSL |
| Host: | Rabbit |
| Isotype: | IgG |
| Purification: | Immunogen affinity purified |
| Appearance: | Liquid |
| Formulation: | pH: 7.20; 0.02% Sodium azide, PBS, 40% Glycerol |
| Applications: | IHC-P, ICC/IF |
| Species Reactivity: | Human |
| Storage: | -20°C. |
| Warning: | For Research Use Only! Not For Use in Humans. |
| Accession: | Q96L91 |
| Alternative Name: | CAG repeat protein 32 antibody/CAGH 32 antibody/CAGH32 antibody |
| Scientific Background: | Component of the NuA4 histone acetyltransferase complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histones H4 and H2A. This modification may both alter nucleosome - DNA interactions and promote interaction of the modified histones with other proteins which positively regulate transcription. May be required for transcriptional activation of E2F1 and MYC target genes during cellular proliferation. The NuA4 complex ATPase and helicase activities seem to be, at least in part, contributed by the association of RUVBL1 and RUVBL2 with EP400. May regulate ZNF42 transcription activity. |
| Product Types | ||
| ◆ Proteins & Enzymes | ||
| PE-2087 | Recombinant Human p400 protein | Inquiry |
| ◆ Antibodies | ||
| EAb-2476 | p400 Polyclonal Antibody | Inquiry |
| EAb-2731 | p400 Polyclonal Antibody | Inquiry |
| Related Gene / Proteins | |||
| p400 | |||
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools
