| Cat.No.: | EAb-2785 |
| Product Name: | JHDM1D Polyclonal Antibody |
| Product Overview: | Rabbit polyclonal to detect JHDM1D |
| Antibody Type: | Polyclonal |
| Immunogen: | Recombinant fragment corresponding to Human JHDM1D aa 411-501. |
| Immunogen Sequence: | LETLKELREDGFQPQTYLVQGVKALHTALKLWMKKELVSEHAFEIPDNVR PGHLIKELSKVIRAIEEENGKPVKSQGIPIVCPVSRSSNEA |
| Host: | Rabbit |
| Isotype: | IgG |
| Purification: | Immunogen affinity purified |
| Appearance: | Liquid |
| Formulation: | 0.02% Sodium azide, 40% Glycerol, PBS |
| Applications: | ICC/IF, IHC-P |
| Species Reactivity: | Human |
| Storage: | -20°C. |
| Warning: | For Research Use Only! Not For Use in Humans. |
| Accession: | Q6ZMT4 |
| Alternative Name: | JHDM1D antibody/jmjc containing protein antibody/JmjC domain-containing histone demethylation protein 1D antibody |
| Scientific Background: | Histone demethylase required for brain development. Specifically demethylates dimethylated 'Lys-9' and 'Lys-27' (H3K9me2 and H3K27me2, respectively) of histone H3 and monomethylated histone H4 'Lys-20' residue (H4K20Me1), thereby playing a central role in histone code. Specifically binds trimethylated 'Lys-4' of histone H3 (H3K4me3), affecting histone demethylase specificity: in presence of H3K4me3, it has no demethylase activity toward H3K9me2, while it has high activity toward H3K27me2. Demethylates H3K9me2 in absence of H3K4me3. Has activity toward H4K20Me1 only when nucleosome is used as a substrate and when not histone octamer is used as substrate. |
| Product Types | ||
| ◆ Research Kits | ||
| EKIT-0470 | JHDM1D (KDM7A) Chemiluminescent Assay Kit | Inquiry |
| EKIT-0472 | JHDM1D (KDM7A) Homogeneous Assay Kit | Inquiry |
| EKIT-0473 | JHDM1D Homogeneous Assay Kit | Inquiry |
| ◆ Proteins & Enzymes | ||
| PE-1795 | JHDM1D (KDM7A), FLAG-tag | Inquiry |
| PE-1799 | FBXL11 (KDM2A, JHDM1A), FLAG-Avi-tags | Inquiry |
| Related Gene / Proteins | |||
| JHDM1A | JHDM1B | JHDM1D | JHDM2A |
| JHDM3A | |||
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools
