KMT4/Dot1L Polyclonal Antibody


  • Specification
  • Target Information
  • Related Products
Cat.No.:  EAb-2952
Product Name:  KMT4/Dot1L Polyclonal Antibody
Product Overview:  Rabbit polyclonal to detect KMT4/Dot1L
Antibody Type:  Polyclonal
Immunogen:  Synthetic peptide within Human KMT4/ Dot1L aa 40-90 conjugated to keyhole limpet haemocyanin.
Immunogen Sequence:  TIRWVCEEIPDLKLAMENYVLIDYDTKSFESMQRLCDKYNRAIDSIHQLW K
Host:  Rabbit
Isotype:  IgG
Purification:  Protein A purified
Appearance:  Liquid
Formulation:  0.09% Sodium azide, 1% BSA, 50% Glycerol
Applications:  IHC-P
Species Reactivity:  Human
Storage:  -20°C.
Warning:  For Research Use Only! Not For Use in Humans.
Accession:  Q8TEK3
Alternative Name:  Disrupter of telomere silencing protein 1 antibody/DOT 1 antibody/DOT1 antibody
Scientific Background:  Histone methyltransferase. Methylates 'Lys-79' of histone H3. Nucleosomes are preferred as substrate compared to free histones. Binds to DNA.
Product Types
◆ Bioactive Small Molecules
BSM-0072 AMI-5 Inquiry
BSM-0126 EPZ-5676 Inquiry
BSM-0128 EPZ004777 Inquiry
BSM-0215 SGC0946 Inquiry
◆ Extracts & Lysates
EL-0139 Recombinant Human DOT1L 293 Cell Lysate Inquiry
Related Gene / Proteins
DOT1L

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Follow us on

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.