DOT1L Polyclonal Antibody


  • Specification
  • Target Information
  • Related Products
Cat.No.:  EAb-3322
Product Name:  DOT1L Polyclonal Antibody
Antibody Type:  Polyclonal
Immunogen:  A synthetic peptide corresponding to a sequence within amino acids 1400-1500 of human DOT1L
Immunogen Sequence:  TDKTPLLSGKAAKARDREVDLKNGHNLFISAAAVPPGSLLSGPGLAPAASSAGGAASSAQTHRSFLGPFPPGPQFALGPMSLQANLGSVAGSSVLQSLFSS
Host:  Rabbit
Isotype:  IgG
Molecular Weight:  170kDa
Purification:  Affinity purification
Appearance:  Liquid
Applications:  WB; IHC; IF
Recommended Dilutions/Conditions:  WB: 1:500 - 1:2000; IHC: 1:50 - 1:200
Recommended dilutions/conditions may not be available for all applications. Specific conditions for reactivity should be optimized by the end user.
Positive Control:  Mouse liver,Rat liver
Species Reactivity:  Human, Mouse, Rat
Storage:  -20℃.
Storage Buffer:  PBS with 0.02% sodium azide,50% glycerol,pH7.3.
Warning:  For Research Use Only! Not For Use in Humans.
Accession:  Swiss Prot Q8TEK3; NP_115871.1; Gene ID 84444
Alternative Name:  DOT1L; DOT1; KMT4; DOT1 like histone lysine methyltransferase
Scientific Background:  The protein encoded by this gene is a histone methyltransferase that methylates lysine-79 of histone H3. It is inactive against free core histones, but shows significant histone methyltransferase activity against nucleosomes.
Product Types
◆ Bioactive Small Molecules
BSM-0072 AMI-5 Inquiry
BSM-0126 EPZ-5676 Inquiry
BSM-0128 EPZ004777 Inquiry
BSM-0215 SGC0946 Inquiry
◆ Extracts & Lysates
EL-0139 Recombinant Human DOT1L 293 Cell Lysate Inquiry
Related Gene / Proteins
DOT1L

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Follow us on

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.