Cat.No.: | EAb-3346 |
Product Name: | IKK alpha Polyclonal Antibody |
Antibody Type: | Polyclonal |
Immunogen: | A synthetic peptide corresponding to a sequence within amino acids 650 to the C-terminus of human IKK alpha |
Immunogen Sequence: | IWHLLKIACTQSSARSLVGSSLEGAVTPQTSAWLPPTSAEHDHSLSCVVTPQDGETSAQMIEENLNCLGHLSTIIHEANEEQGNSMMNLDWSWLTE |
Host: | Rabbit |
Isotype: | IgG |
Molecular Weight: | 94kDa |
Purification: | Affinity purification |
Appearance: | Liquid |
Applications: | WB; IHC; IF; IP |
Recommended Dilutions/Conditions: |
WB: 1:500 - 1:2000; IHC: 1:50 - 1:200; IP: 1:50 - 1:200 Recommended dilutions/conditions may not be available for all applications. Specific conditions for reactivity should be optimized by the end user. |
Positive Control: | HeLa,NIH/3T3,HT-29 |
Species Reactivity: | Human, Mouse, Rat |
Storage: | -20℃. |
Storage Buffer: | PBS with 0.02% sodium azide,50% glycerol,pH7.3. |
Warning: | For Research Use Only! Not For Use in Humans. |
Accession: | Swiss Prot O15111; NP_001269.3; Gene ID 1147 |
Alternative Name: | CHUK; IKBKA; IKK-alpha; IKK1; IKKA; NFKBIKA; TCF16; conserved helix-loop-helix ubiquitous kinase |
Scientific Background: | This gene encodes a member of the serine/threonine protein kinase family. The encoded protein, a component of a cytokine-activated protein complex that is an inhibitor of the essential transcription factor NF-kappa-B complex, phosphorylates sites that trigger the degradation of the inhibitor via the ubiquination pathway, thereby activating the transcription factor. |
Product Types | ||
◆ Cell Lines | ||
CL-0052 | Human IKBKG Knockout Cell Line 269bp insertion | Inquiry |
◆ Bioactive Small Molecules | ||
BSM-0323 | BMS 345541 (trifluoroacetate salt) | Inquiry |
◆ Antibodies | ||
EAb-1951 | IKKγ Monoclonal Antibody | Inquiry |
EAb-1952 | IKKi/IKKε Polyclonal Antibody | Inquiry |
EAb-1953 | IKKβ Monoclonal Antibody | Inquiry |
Related Gene / Proteins | |||
Ikaros | IKBKG | IKK |
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools