| Cat.No.: | PE-0619 |
| Product Name: | Recombinant Human YY1 |
| Product Overview: | Recombinant fragment amino acids 221-320 of Human YY1 with a proprietary tag at N-terminal: predicted molecular weight 36.63 kDa. |
| Description: | YY1 is a ubiquitously distributed transcription factor belonging to the GLI-Kruppel class of zinc finger proteins. The protein is involved in repressing and activating a diverse number of promoters.YY1 may direct histone deacetylases and histone acetyltransferases to a promoter in order to activate or repress the promoter, thus implicating histone modification in the function of YY1. |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Molecular Weight: | 36.630kDa inclusive of tags |
| Species: | Human |
| Amino Acid Sequence: | VTMWSSDEKKDIDHETVVEEQIIGENSPPDYSEYMTGKKLPPGGIPGIDLSDPKQLAEFARMKPRKIKEDDAPRTIACPHKGCTKMFRDNSAMRKHLHTH |
| Sequence Similarities: | Belongs to the YY transcription factor family.Contains 4 C2H2-type zinc fingers. |
| Expression System: | Wheat germ |
| Protein Length: | 100 amino acids |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Gene Name: | YY1 YY1 transcription factor [ Homo sapiens ] |
| Gene ID NCBI: | 7528 |
| Official Symbol: | YY1 |
| Synonyms: | YY1; YY1 transcription factor; transcriptional repressor protein YY1; DELTA; INO80 complex subunit S; INO80S; NF E1; UCRBP; Yin and Yang 1 protein; YIN YANG 1; |
| mRNA Refseq: | NM_003403 |
| Protein Refseq: | NP_003394 |
| MIM: | 600013 |
| UniProt ID: | P25490 |
| Chromosome Location: | 14q |
| Function: | DNA binding; RNA binding; four-way junction DNA binding; metal ion binding; protein binding; |
| Product Types | ||
| ◆ Extracts & Lysates | ||
| EL-0075 | Recombinant Human YY1 293 Cell Lysate | Inquiry |
| ◆ Proteins & Enzymes | ||
| PE-0618 | Recombinant Human YY1, His-tagged | Inquiry |
| PE-0619 | Recombinant Human YY1 | Inquiry |
| PE-0620 | Recombinant Human YY1, FLAG-tagged | Inquiry |
| PE-0621 | Recombinant Human YY1, His-tagged | Inquiry |
| Related Gene / Proteins | |||
| YY1 | |||
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools
