| Cat.No.: | PE-0746 |
| Product Name: | Recombinant Human RUNX2 |
| Product Overview: | Recombinant fragment corresponding to amino acids 311-450 of Human RUNX2 with a proprietary tag at N-terminal; Predicted MWt 41.03kDa inclusive of tag. |
| Description: | This gene is a member of the RUNX family of transcription factors and encodes a nuclear protein with an Runt DNA-binding domain. This protein is essential for osteoblastic differentiation and skeletal morphogenesis and acts as a scaffold for nucleic acids and regulatory factors involved in skeletal gene expression. The protein can bind DNA both as a monomer or, with more affinity, as a subunit of a heterodimeric complex. Mutations in this gene have been associated with the bone development disorder cleidocranial dysplasia (CCD). Transcript variants that encode different protein isoforms result from the use of alternate promoters as well as alternate splicing. |
| Tissue Specificity: | Specifically expressed in osteoblasts. |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Molecular Weight: | 41.030kDa |
| Species: | Human |
| Amino Acid Sequence: | TSPSIHSTTPLSSTRGTGLPAITDVPRRISDDDTATSDFCLWPSTLSKKSQAGASELGPFSDPRQFPSISSLTESRFSNPRMHYPATFTYTPPVTSGMSLGMSATTHYHTYLPPPYPGSSQSQSGPFQTSSTPYLYYGTS |
| Sequence Similarities: | Contains 1 Runt domain. |
| Expression System: | Wheat germ |
| Protein Length: | 140 amino acids |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Gene Name: | RUNX2 runt-related transcription factor 2 [ Homo sapiens ] |
| Gene ID NCBI: | 860 |
| Official Symbol: | RUNX2 |
| Synonyms: | RUNX2; runt-related transcription factor 2; CBFA1, CCD, CCD1; AML3; PEBP2A1; PEBP2aA1; |
| mRNA Refseq: | NM_001015051 |
| Protein Refseq: | NP_001015051 |
| MIM: | 600211 |
| UniProt ID: | Q13950 |
| Chromosome Location: | 6p21 |
| Function: | ATP binding; DNA binding; protein binding; sequence-specific DNA binding transcription factor activity; |
| Product Types | ||
| ◆ Antibodies | ||
| EAb-0042 | Runx1/AML1-ETO Polyclonal Antibody | Inquiry |
| EAb-0313 | RUNX2 Polyclonal Antibody | Inquiry |
| ◆ Extracts & Lysates | ||
| EL-0092 | Recombinant Human RUNX2 293 Cell Lysate | Inquiry |
| EL-0093 | Recombinant Human RUNX2 293 Cell Lysate | Inquiry |
| ◆ Proteins & Enzymes | ||
| PE-0746 | Recombinant Human RUNX2 | Inquiry |
| Related Gene / Proteins | |||
| Runx1 | RUNX2 | RUVB2 | RUVBL1 |
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools
