| Cat.No.: | PE-1495 |
| Product Name: | Recombinant Human C20ORF20, His-tagged |
| Product Overview: | Recombinant fragment, corresponding to amino acids 22-204 of Human C20orf20 with an N terminal His tag. Predicted MWt: 22 kDa; |
| Description: | Component of the NuA4 histone acetyltransferase (HAT) complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histones H4 and H2A. |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Species: | Human |
| Formulation: | Lyophilised:Reconstitute with 69 μl aqua dest. |
| Tag: | His |
| Amino Acid Sequence: | TSPAEETVVWSPEVEVCLFHAMLGHKPVGVNRHFHMICIR DKFSQNIGRQVPSKVIWDHLSTMYDMQALHESEILPFP NPERNFVLPEEIIQEVREGKVMIEEEMKEEMKEDVDPH NGADDVFSSSGSLGKASEKSSKDKEKNSSDLGCKEGADKR KRSRVTDKVLTANSNPSSPSAAKRRRT |
| Sequence Similarities: | Belongs to the EAF7 family. |
| Expression System: | E. coli |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Gene Name: | C20orf20 chromosome 20 open reading frame 20 [ Homo sapiens ] |
| Gene ID NCBI: | 55257 |
| Official Symbol: | C20ORF20 |
| Synonyms: | C20ORF20; chromosome 20 open reading frame 20; MRG-binding protein; Eaf7; FLJ10914; MRG15BP; MRGBP; |
| mRNA Refseq: | NM_018270 |
| Protein Refseq: | NP_060740 |
| MIM: | 611157 |
| UniProt ID: | Q9NV56 |
| Chromosome Location: | 20q13.33 |
| Product Types | ||
| ◆ Extracts & Lysates | ||
| EL-0223 | Recombinant Human C20orf20 293 Cell Lysate | Inquiry |
| ◆ Proteins & Enzymes | ||
| PE-1494 | Recombinant Human Chromosome 20 0pen Reading Frame 20, His-tagged | Inquiry |
| PE-1495 | Recombinant Human C20ORF20, His-tagged | Inquiry |
| PE-1496 | Recombinant Human C20ORF20, His-tagged | Inquiry |
| PE-2675 | Recombinant Human C20orf20 protein | Inquiry |
| Related Gene / Proteins | |||
| C20orf20 | |||
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools
