Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Tnfsf11

  • Official Full Name

    tumor necrosis factor (ligand) superfamily, member 11

  • Overview

    This gene encodes a member of the tumor necrosis factor (TNF) cytokine family which is a ligand for osteoprotegerin and functions as a key factor for osteoclast differentiation and activation. This protein was shown to be a dentritic cell survival factor and is involved in the regulation of T cell-dependent immune response. T cell activation was reported to induce expression of this gene and lead to an increase of osteoclastogenesis and bone loss. This protein was shown to activate antiapoptotic kinase AKT/PKB through a signaling complex involving SRC kinase and tumor necrosis factor receptor-associated factor (TRAF) 6, which indicated this protein may have a role in the regulation of cell apoptosis. Targeted disruption of the related gene in mice led to severe osteopetrosis and a lack of osteoclasts. The deficient mice exhibited defects in early differentiation of T and B lymphocytes, and failed to form lobulo-alveolar mammary structures during pregnancy. Two alternatively spliced transcript variants have been found.
  • Synonyms

    TNFSF11; tumor necrosis factor (ligand) superfamily, member 11; ODF; OPGL; sOdf; CD254; OPTB2; RANKL; TRANCE; hRANKL2; tumor necrosis factor ligand superfamily member 11; OTTHUMP00000018328; OTTHUMP00000178585; osteoprotegerin ligand; osteoclast differentiation factor; TNF-related activation-induced cytokine; receptor activator of nuclear factor kappa B ligand; receptor activator of nuclear factor kappa-B ligand;

  • Recombinant Proteins
  • Cell & Tissue Lysates
  • Recombinant Antibodies
  • Protein Pre-coupled Magnetic Beads
  • Chicken
  • Cynomolgus
  • Cynomolgus Monkey
  • Homo sapiens (Human)
  • Human
  • Monkey
  • Mouse
  • Mus musculus (Mouse)
  • Rat
  • CHO
  • E. coli
  • E.coli
  • E.coli expression system
  • HEK293
  • HEK293F
  • HEK293T
  • Human
  • Human Cell
  • Human Cells
  • Insect Cell
  • Mammalian Cell
  • Mammalian cells
  • Nicotiana Benthamiana
  • Sf9
  • Yeast
  • Avi
  • Fc
  • C
  • His
  • DYKDDDDK
  • Fc|His
  • Flag
  • GST
  • His (Fc)
  • His(C
  • ter)
  • His|GST
  • His|T7
  • SUMO
  • human|IgG1|Fc
  • Met
  • mFc
  • Myc
  • DDK
  • Myc|DDK
  • N/A
  • N
  • hFc
  • rFc
Species Cat.# Product name Source (Host) Tag Protein Length Price
Human TNFSF11-251H Active Recombinant Human TNFSF11 Mammalian cells N/A
Human TNFSF11-4744H Active Recombinant Human Tumor Necrosis Factor (ligand) Superfamily, Member 11 E.coli N/A
Human TNFSF11-252H Active Recombinant Human TNFSF11, Met-tagged E.coli Met
Human TNFSF11-873H Active Recombinant Human TNFSF11 Protein, His-tagged HEK293 His
Human TNFSF11-3253H Active Recombinant Human TNFSF11 protein(Gly 63-Asp 244), rFc-tagged HEK293 N-rFc Gly 63-Asp 244
Human TNFSF11-3744H Recombinant Human TNFSF11, His-tagged E.coli His
Human TNFSF11-4154H Recombinant Human Tumor Necrosis Factor (ligand) Superfamily, Member 11, GST-tagged Human GST
Human TNFSF11-3553H Recombinant Human TNFSF11, His-tagged Human His
Human TNFSF11-P1002H Recombinant Human Osteoprotegerin Ligand CHO N/A
Human TNFSF11-349H Recombinant Human Tumor Necrosis Factor (ligand) Superfamily, Member 11,His-tagged Human His
Human TNFSF11-208H Recombinant Human TNFSF11, Fc tagged Human Cell Fc
Human TNFSF11-144H Recombinant Human TNFSF11, His-tagged, Animal Free Nicotiana Benthamiana His
Human TNFSF11-1564H Recombinant human TNFSF11, Active, His-tagged Nicotiana Benthamiana His
Human TNFSF11-31288TH Recombinant Human TNFSF11 E.coli N/A
Human TNFSF11-424H Recombinant Human TNFSF11, Fc tagged Human Cell Fc/His
Human TNFSF11-1679H Recombinant Human TNFSF11 Mammalian cells N/A
Human TNFSF11-8548H Recombinant Human TNFSF11, None tagged Human Cell Fc/His
Human TNFSF11-322H Active Recombinant Human TNFSF11 protein, mFc-tagged HEK293 mFc Gly63-Asp244
Human VEGFA-587H Recombinant Human Tumor Necrosis Factor (Ligand) Superfamily, Member 11, His-Fc-Tagged Human Fc/His
Human TNFSF11-473H Recombinant Human TNFSF11, FLAG-tagged HEK293 Flag
Human TNFSF11-1567H Recombinant Human TNFSF11 protein E.coli N/A
Human TNFSF11-117H Recombinant Human Tumor Necrosis Factor (Ligand) Superfamily, Member 11 E.coli N/A
Human TNFSF11-1093HCL Recombinant Human TNFSF11 cell lysate Human Cell N/A
Human TNFSF11-998HCL Recombinant Human TNFSF11 cell lysate Human Cell N/A
Human CABT-P1009H Recombinant Anti-Human RANKL Monoclonal Antibody N/A
Human TNFSF11-394H Active Recombinant Human TNFSF11 protein, His-tagged HEK293 His Gly 64 - Asp 245
Human TNFSF11-209H Active Recombinant Human TNFSF11 protein, Avi-Fc-tagged, Biotinylated HEK293 Avi-Fc Gly 64 - Asp 245
Human TNFSF11-425H Active Recombinant Human TNFSF11 protein, rFc-tagged(HPLC-verified) HEK293 rFc Gly64-Asp245
Human TNFSF11-395H Recombinant Human TNFSF11 protein, Fc-tagged HEK293 human/IgG1/Fc 182
Human TNFSF11-151H Recombinant Human TNFSF11 Protein, DYKDDDDK-tagged Human Cells DYKDDDDK
Human TNFSF11-762H Recombinant Human TNFSF11 protein, His-Flag-tagged HEK293 His-Flag Leu160-Val313
Human TNFSF11-459H Recombinant Human TNFSF11 Protein, His-tagged HEK293 His 317
Human TNFSF11-424HAF555 Recombinant Human TNFSF11 Protein, Fc-tagged, Alexa Fluor 555 conjugated HEK293 Fc 431
Human TNFSF11-424HAF488 Recombinant Human TNFSF11 Protein, Fc-tagged, Alexa Fluor 488 conjugated HEK293 Fc 431
Human TNFSF11-2650H Recombinant Human TNFSF11 Protein, Myc/DDK-tagged, C13 and N15-labeled HEK293T Myc/DDK
Human TNFSF11-0755H Active Recombinant Human TNFSF11 protein HEK293 N/A Gly64-Asp245
Human TNFSF11-322HAF647 Recombinant Human TNFSF11 Protein, Fc-tagged, Alexa Fluor 647 conjugated HEK293 Fc 418
Human TNFSF11-322HAF555 Recombinant Human TNFSF11 Protein, Fc-tagged, Alexa Fluor 555 conjugated HEK293 Fc 418
Human TNFSF11-2022H Recombinant Human TNFSF11 Protein, MYC/DDK-tagged HEK293 Myc/DDK
Human TNFSF11-0756H Active Recombinant Human TNFSF11 protein, His-Avi-tagged, Biotinylated HEK293 His-Avi Gly64-Asp245
Human TNFSF11-8548HAF647 Recombinant Human TNFSF11 Protein, None-tagged, Alexa Fluor 647 conjugated HEK293 N/A 182
Human TNFSF11-8548HAF555 Recombinant Human TNFSF11 Protein, None-tagged, Alexa Fluor 555 conjugated HEK293 N/A 182
Human TNFSF11-152H Recombinant Human TNFSF11 Protein, DYKDDDDK-tagged Human Cells DYKDDDDK
Human TNFSF11-0757H Active Recombinant Human TNFSF11 protein(Gly64-Asp245), hFc-tagged HEK293 N-hFc Gly64-Asp245
Human TNFSF11-322HF Recombinant Human TNFSF11 Protein, Fc-tagged, FITC conjugated HEK293 Fc 418
Human TNFSF11-424HAF647 Recombinant Human TNFSF11 Protein, Fc-tagged, Alexa Fluor 647 conjugated HEK293 Fc 431
Human TNFSF11-322HAF488 Recombinant Human TNFSF11 Protein, Fc-tagged, Alexa Fluor 488 conjugated HEK293 Fc 418
Human TNFSF11-424HF Recombinant Human TNFSF11 Protein, Fc-tagged, FITC conjugated HEK293 Fc 431
Human TNFSF11-8548HF Recombinant Human TNFSF11 Protein, None-tagged, FITC conjugated HEK293 N/A 182
Human TNFSF11-1530H Recombinant Human TNFSF11 protein, His-tagged HEK293 His 63-244aa&linker(NKLLVPRGSPGSGYIPEAPRDGQAYVRKDGEWVLLSTFLG)
Human TNFSF11-316H Recombinant Active Human TNFSF11 Protein, His-tagged(C-ter) E.coli His(C-ter)
Human TNFSF11-0265H Active Recombinant Human TNFSF11 protein, mFc-tagged HEK293 mFc Gly 64 - Asp 245
Human TNFSF11-1529H Recombinant Human TNFSF11 protein, His-tagged HEK293 His 63-244aa
Human TNFSF11-5228H Recombinant Human TNFSF11 Protein (Gly136-Asp317), N-Fc tagged Mammalian cells N-Fc Gly136-Asp317
Human TNFSF11-2200H Active Recombinant Human TNFSF11 protein HEK293 N/A Gly64-Asp245
Human TNFSF11-4498H Recombinant Human TNFSF11 Protein, His (Fc)-Avi-tagged HEK293 His (Fc)-Avi
Human TNFSF11-8548HAF488 Recombinant Human TNFSF11 Protein, None-tagged, Alexa Fluor 488 conjugated HEK293 N/A 182
Human TNFSF11-4498H-B Recombinant Human TNFSF11 Protein Pre-coupled Magnetic Beads HEK293
Human TNFSF11-6646H Recombinant Human TNFSF11 Protein (Ile140-Asp317), N-His tagged E.coli N-His Ile140-Asp317
Human TNFSF11-254H Active Recombinant Human TNFSF11 Protein E.coli
Human TNFSF11-6647H Recombinant Human TNFSF11 Protein (Gly136-Asp316), N-Fc tagged Mammalian cells N-Fc Gly136-Asp316
Human TNFSF11-5227H Recombinant Human TNFSF11 Protein (Tyr69-Asp317), C-His tagged Mammalian cells C-His Tyr69-Asp317
Human TNFSF11-302H Active Recombinant Human TNFSF11 Protein (Glu143-Asp317), C-His tagged, Animal-free, Carrier-free E.coli C-His Glu143-Asp317
Mouse Tnfsf11-474M Active Recombinant Mouse Tumor Necrosis Factor (Ligand) Superfamily, Member 11 E.coli N/A
Mouse Tnfsf11-953M Active Recombinant Mouse Tnfsf11 Protein, His-tagged Mammalian cells His Arg72-Asp316
Mouse TNFSF11-860M Active Recombinant Mouse TNFSF11 Protein, Fc-tagged HEK293 Fc
Mouse Tnfsf11-247M Active Recombinant Mouse Tnfsf11, Fc-tagged HEK293 Fc
Mouse TNFSF11-860MAF488 Active Recombinant Mouse Tnfsf11 Protein, Fc-tagged, Alexa Fluor 488 conjugated HEK293 Fc 505
Mouse TNFSF11-860MAF555 Active Recombinant Mouse Tnfsf11 Protein, Fc-tagged, Alexa Fluor 555 conjugated HEK293 Fc 505
Mouse TNFSF11-860MAF647 Active Recombinant Mouse Tnfsf11 Protein, Fc-tagged, Alexa Fluor 647 conjugated HEK293 Fc 505
Mouse TNFSF11-860MF Active Recombinant Mouse Tnfsf11 Protein, Fc-tagged, FITC conjugated HEK293 Fc 505
Mouse Tnfsf11-116M Recombinant Mouse Tumor Necrosis Factor (Ligand) Superfamily, Member 11 E.coli N/A
Mouse Tnfsf11-198M Recombinant Mouse TNFSF11, Fc-tagged Human Cell N/A
Mouse Tnfsf11-528M Recombinant Mouse Tnfsf11 protein, His-tagged HEK293F His
Mouse Tnfsf11-190M Recombinant Mouse Tnfsf11, His-tagged Mammalian cells His
Mouse Tnfsf11-192M Recombinant Mouse TNFSF11 Yeast N/A
Mouse Tnfsf11-7835M Recombinant Mouse Tnfsf11 protein, His & GST-tagged E.coli His/GST Leu92~Trp263 (Accession# O35235)
Mouse Tnfsf11-2123M Recombinant Mouse Tnfsf11, Fc Chimera HEK293 Fc
Mouse TNFSF11-1586MCL Recombinant Mouse TNFSF11 cell lysate Human Cell N/A
Mouse TNFSF11-2024M Recombinant Mouse TNFSF11 Protein E.coli N/A
Mouse Tnfsf11-6551M Active Recombinant Mouse Tnfsf11 Protein E. coli
Mouse Tnfsf11-85M Active Recombinant Mouse Tnfsf11 Protein (Pro143-Asp316), C-His tagged, Animal-free, Carrier-free E.coli C-His Pro143-Asp316
Mouse TNFSF11-683M Recombinant Mouse TNFSF11 Protein E.coli N/A 158-316 aa
Mouse Tnfsf11-6784M Recombinant Mouse Tnfsf11 Protein (Ala73-Asp316), C-His tagged Mammalian cells C-His Ala73-Asp316
Mouse TNFSF11-2023M Recombinant Mouse TNFSF11 Protein, His-tagged Insect Cell His
Mouse TNFSF11-255M Active Recombinant Mouse TNFSF11 Protein E.coli
Mouse Tnfsf11-6552M Active Recombinant Mouse Tnfsf11 Protein, His-tagged Sf9 His Lis158-Asp316
Mouse Tnfsf11-1258M Recombinant Mouse Tnfsf11 Protein, His-tagged HEK293F N-His Arg72-Asp316
Mouse Tnfsf11-3604M Recombinant Mouse Tnfsf11 protein, His-SUMO-tagged E.coli His-SUMO 70-316aa
Mouse Tnfsf11-2138M Recombinant Mouse Tnfsf11 Protein, His-tagged E.coli N-His Ala73-Ile315
Mouse Tnfsf11-317M Recombinant Active Mouse TNFSF11 Protein, His-tagged(C-ter) E.coli His(C-ter)
Mouse Tnfsf11-9481M-B Recombinant Mouse Tnfsf11 Protein Pre-coupled Magnetic Beads HEK293
Mouse Tnfsf11-9481M Recombinant Mouse Tnfsf11 Protein, His (Fc)-Avi-tagged HEK293 His (Fc)-Avi
Rat Tnfsf11-196R Active Recombinant Rat Tnfsf11 protein, His-tagged CHO His
Rat Tnfsf11-7836R Recombinant Rat Tnfsf11 protein, His & T7-tagged E.coli His/T7 Glu106~Met240 (Accession # Q9ESE2)
Rat TNFSF11-6202R Recombinant Rat TNFSF11 Protein Mammalian Cell His
Rat Tnfsf11-2680R Recombinant Rat Tnfsf11 E.coli N/A
Rat TNFSF11-59R Recombinant Rat TNFSF11 (RANKL) Yeast N/A
Rat TNFSF11-5859R-B Recombinant Rat TNFSF11 Protein Pre-coupled Magnetic Beads HEK293
Rat TNFSF11-5859R Recombinant Rat TNFSF11 Protein, His (Fc)-Avi-tagged HEK293 His (Fc)-Avi
Rat TNFSF11-0754R Active Recombinant Rat TNFSF11 protein, His-Avi-tagged, Biotinylated HEK293 His-Avi Leu69-Asp318
Rat TNFSF11-2025R Recombinant Rat TNFSF11 Protein E.coli N/A
Monkey TNFSF11-210CF Active Recombinant Monkey TNFSF11 Protein, Fc-tagged, FITC conjugated HEK293 Fc Gly136-Asp317, 442
Monkey TNFSF11-210CAF488 Active Recombinant Monkey TNFSF11 Protein, Fc-tagged, Alexa Fluor 488 conjugated HEK293 Fc Gly136-Asp317, 442
Monkey TNFSF11-210CAF647 Active Recombinant Monkey TNFSF11 Protein, Fc-tagged, Alexa Fluor 647 conjugated HEK293 Fc Gly136-Asp317, 442
Monkey TNFSF11-210CAF555 Active Recombinant Monkey TNFSF11 Protein, Fc-tagged, Alexa Fluor 555 conjugated HEK293 Fc Gly136-Asp317, 442
Cynomolgus TNFSF11-210C Active Recombinant Cynomolgus TNFSF11 protein(Gly136-Asp317), hFc-tagged HEK293 N-hFc Gly136-Asp317
Cynomolgus Monkey TNFSF11-001CCL Recombinant Cynomolgus TNFSF11 cell lysate Human Cell N/A
Homo sapiens (Human) RFL35557HF Recombinant Full Length Human Tumor Necrosis Factor Ligand Superfamily Member 11(Tnfsf11) Protein, His-Tagged E.coli expression system His Full Length (1-317)
Mus musculus (Mouse) RFL26214MF Recombinant Full Length Mouse Tumor Necrosis Factor Ligand Superfamily Member 11(Tnfsf11) Protein, His-Tagged E.coli expression system His Full Length (1-316)
Chicken TNFSF11-3677C Recombinant Chicken TNFSF11 Mammalian Cell His
  • Involved Pathway
  • Protein Function
  • Interacting Protein
  • Tnfsf11 Related Articles
  • Tnfsf11 Related Gene Family
  • Tnfsf11 Related Signal Pathway

Tnfsf11 involved in several pathways and played different roles in them. We selected most pathways Tnfsf11 participated on our site, such as Cytokine-cytokine receptor interaction, NF-kappa B signaling pathway, Osteoclast differentiation, which may be useful for your reference. Also, other proteins which involved in the same pathway with Tnfsf11 were listed below. Creative BioMart supplied nearly all the proteins listed, you can search them on our site.

Pathway Name Pathway Related Protein
Cytokine-cytokine receptor interactionIFNE;IL21R.1;IFNB1;TSLP;CCL22;CSF3R;CCL25B;CXCL13;TGFBR1
NF-kappa B signaling pathwayCCL21;GADD45B;CD40LG;TRIM25;RIPK1;LCK;MAP3K7;IL-8;ERC1
Osteoclast differentiationFOSL2;IL1B;CSF1R;FYN;LILRB5;SOCS3;SIRPB1;BTK;MAPK8
Prolactin signaling pathwayGRB2;MAPK9;STAT1;MAPK12;PIK3CD;MAPK11;SHC2;RAF1;CSH
Rheumatoid arthritisHLA-DRB3;ATP6V0E1;HLA-DMB;CXCL1;MMP3;Ctsl;CCL2;CTLA4;HLA-DQA2

Tnfsf11 has several biochemical functions, for example, cytokine activity, tumor necrosis factor receptor binding, tumor necrosis factor receptor superfamily binding. Some of the functions are cooperated with other proteins, some of the functions could acted by Tnfsf11 itself. We selected most functions Tnfsf11 had, and list some proteins which have the same functions with Tnfsf11. You can find most of the proteins on our site.

Function Related Protein
cytokine activityIL1F10;Il23a; Il12b;GREM2;FAM3D;INHBC;TSLP;BMP7A;CD70;IFNA21
tumor necrosis factor receptor bindingTNFB;TNFSF14;TNFSF10L;TNFSF4;CD70;TNFSF9;FASLG;TNFSF13;TNFSF8
tumor necrosis factor receptor superfamily bindingTNFSF18;TNFSF11;FADD;TNFSF9;TNFSF4

Tnfsf11 has direct interactions with proteins and molecules. Those interactions were detected by several methods such as yeast two hybrid, co-IP, pull-down and so on. We selected proteins and molecules interacted with Tnfsf11 here. Most of them are supplied by our site. Hope this information will be useful for your research of Tnfsf11.

MED24; SBF1; DDAH2; PLK1; LMO4; EEF1A1; MBTPS1; EZH2; SNRNP35; ZC3HC1; TRMT2A; BBS10; FAM213B; PHAX; TMOD3; CEP126

Baldo, BA; et al. Adverse events to monoclonal antibodies used for cancer therapy Focus on hypersensitivity responses. ONCOIMMUNOLOGY 2:-(2013).
Pise-Masison, CA; Radonovich, M; et al. Gene expression profiling of ATL patients: compilation of disease-related genes and evidence for TCF4 involvement in BIRC5 gene expression and cell viability. BLOOD 113:4016-4026(2009).
  • Q&As
  • Reviews

Q&As (6)

Ask a question
How can the expression level of TNFSF11 protein be used for disease diagnosis and prognosis assessment? 09/19/2022

It is possible to detect the expression level of TNFSF11 protein to help diagnose tumors and other diseases, and to assess their prognosis and treatment effectiveness.

How to use the activity of TNFSF11 protein for disease treatment? 03/14/2022

At present, a variety of drugs have been developed to target TNFSF11 proteins and their related signaling pathways, including inhibiting their expression and inhibiting their binding to receptors, etc., for the treatment of tumors and other bone metabolism-related diseases.

What is the relationship between TNFSF11 proteins and infectious diseases? 08/11/2021

Studies have shown that TNFSF11 proteins can be involved in the regulation of infectious diseases, such as playing a role in some viral infections.

How well are TNFSF11 proteins expressed in different tissues and organs? 10/06/2020

There are differences in the expression of TNFSF11 proteins in different tissues and organs, and they are expressed in tissues and organs such as the immune system, bones, and teeth, and the expression level may be affected by many factors.

What is the relationship between TNFSF11 proteins and autoimmune diseases? 04/02/2020

Studies have shown that TNFSF11 proteins can be involved in the regulation of autoimmune diseases, such as in autoimmune diseases such as rheumatoid arthritis.

What is the relationship between TNFSF11 proteins and other TNF superfamily members? 01/31/2019

TNFSF11 protein belongs to the TNF superfamily and has certain structural and functional similarities with other members of the TNF superfamily.

Customer Reviews (3)

Write a review
Reviews
10/14/2022

    The reproducibility of TNFSF11 is so good that the results are highly consistent regardless of the conditions under which the experiment or application is performed, greatly reducing the experimental error.

    11/24/2020

      Green production process of TNFSF11 is highly commendable, which uses the most advanced biotechnology to increase production efficiency and reduce environmental impact.

      07/22/2020

        The short half-life and high clearance of TNFSF11 make it better able to adapt to changing treatment needs and provide patients with more flexible treatment options.

        Ask a Question for All Tnfsf11 Products

        Required fields are marked with *

        My Review for All Tnfsf11 Products

        Required fields are marked with *

        logo

        FOLLOW US

        Terms and Conditions        Privacy Policy

        Copyright © 2024 Creative BioMart. All Rights Reserved.

        Contact Us

        • /

        Stay Updated on the Latest Bioscience Trends