Recombinant Mouse Tnfsf11 protein, His-SUMO-tagged
| Cat.No. : | Tnfsf11-3604M |
| Product Overview : | Recombinant Mouse Tnfsf11 protein(O35235)(70-316aa), fused to N-terminal His-SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 70-316aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 43.9 kDa |
| AA Sequence : | YFRAQMDPNRISEDSTHCFYRILRLHENADLQDSTLESEDTLPDSCRRMKQAFQGAVQKELQHIVGPQRFSGAPAMMEGSWLDVAQRGKPEAQPFAHLTINAASIPSGSHKVTLSSWYHDRGWAKISNMTLSNGKLRVNQDGFYYLYANICFRHHETSGSVPTDYLQLMVYVVKTSIKIPSSHNLMKGGSTKNWSGNSEFHFYSINVGGFFKLRAGEEISIQVSNPSLLDPDQDATYFGAFKVQDID |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | Tnfsf11 tumor necrosis factor (ligand) superfamily, member 11 [ Mus musculus ] |
| Official Symbol | Tnfsf11 |
| Synonyms | TNFSF11; tumor necrosis factor (ligand) superfamily, member 11; tumor necrosis factor ligand superfamily member 11; OPG ligand; osteoprotegerin ligand; osteoclast differentiation factor; receptor activator of NF-kappaB ligand; TNF-related activation-induced cytokine; receptor activator of nuclear factor kappa B ligand; receptor activator of nuclear factor kappa-B ligand; tumor necrosis factor-related activation-induced cytokine; ODF; OPG; OPGL; RANKL; Ly109l; Trance; |
| Gene ID | 21943 |
| mRNA Refseq | NM_011613 |
| Protein Refseq | NP_035743 |
| ◆ Recombinant Proteins | ||
| TNFSF11-6646H | Recombinant Human TNFSF11 Protein (Ile140-Asp317), N-His tagged | +Inquiry |
| Tnfsf11-6552M | Active Recombinant Mouse Tnfsf11 Protein, His-tagged | +Inquiry |
| TNFSF11-3253H | Active Recombinant Human TNFSF11 protein(Gly 63-Asp 244), rFc-tagged | +Inquiry |
| TNFSF11-5859R | Recombinant Rat TNFSF11 Protein, His (Fc)-Avi-tagged | +Inquiry |
| TNFSF11-1530H | Recombinant Human TNFSF11 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TNFSF11-1093HCL | Recombinant Human TNFSF11 cell lysate | +Inquiry |
| TNFSF11-1586MCL | Recombinant Mouse TNFSF11 cell lysate | +Inquiry |
| TNFSF11-998HCL | Recombinant Human TNFSF11 cell lysate | +Inquiry |
| TNFSF11-001CCL | Recombinant Cynomolgus TNFSF11 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Tnfsf11 Products
Required fields are marked with *
My Review for All Tnfsf11 Products
Required fields are marked with *
