Recombinant Mouse Tnfsf11 protein, His-SUMO-tagged

Cat.No. : Tnfsf11-3604M
Product Overview : Recombinant Mouse Tnfsf11 protein(O35235)(70-316aa), fused to N-terminal His-SUMO tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His&SUMO
Protein Length : 70-316aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 43.9 kDa
AA Sequence : YFRAQMDPNRISEDSTHCFYRILRLHENADLQDSTLESEDTLPDSCRRMKQAFQGAVQKELQHIVGPQRFSGAPAMMEGSWLDVAQRGKPEAQPFAHLTINAASIPSGSHKVTLSSWYHDRGWAKISNMTLSNGKLRVNQDGFYYLYANICFRHHETSGSVPTDYLQLMVYVVKTSIKIPSSHNLMKGGSTKNWSGNSEFHFYSINVGGFFKLRAGEEISIQVSNPSLLDPDQDATYFGAFKVQDID
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name Tnfsf11 tumor necrosis factor (ligand) superfamily, member 11 [ Mus musculus ]
Official Symbol Tnfsf11
Synonyms TNFSF11; tumor necrosis factor (ligand) superfamily, member 11; tumor necrosis factor ligand superfamily member 11; OPG ligand; osteoprotegerin ligand; osteoclast differentiation factor; receptor activator of NF-kappaB ligand; TNF-related activation-induced cytokine; receptor activator of nuclear factor kappa B ligand; receptor activator of nuclear factor kappa-B ligand; tumor necrosis factor-related activation-induced cytokine; ODF; OPG; OPGL; RANKL; Ly109l; Trance;
Gene ID 21943
mRNA Refseq NM_011613
Protein Refseq NP_035743

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Tnfsf11 Products

Required fields are marked with *

My Review for All Tnfsf11 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon