Recombinant Human TNFSF11 protein, His-tagged
Cat.No. : | TNFSF11-1530H |
Product Overview : | Recombinant Human TNFSF11 protein(O14788)(63-244aa&linker(NKLLVPRGSPGSGYIPEAPRDGQAYVRKDGEWVLLSTFLG)), fused to N-terminal His tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 63-244aa&linker(NKLLVPRGSPGSGYIPEAPRDGQAYVRKDGEWVLLSTFLG) |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 27.5 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-81°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4℃ before opening to recover the entire contents. |
Gene Name | TNFSF11 tumor necrosis factor (ligand) superfamily, member 11 [ Homo sapiens ] |
Official Symbol | TNFSF11 |
Synonyms | TNFSF11; tumor necrosis factor (ligand) superfamily, member 11; tumor necrosis factor ligand superfamily member 11; CD254; ODF; OPGL; RANKL; TRANCE; osteoprotegerin ligand; osteoclast differentiation factor; TNF-related activation-induced cytokine; receptor activator of nuclear factor kappa B ligand; receptor activator of nuclear factor kappa-B ligand; sOdf; OPTB2; hRANKL2; |
Gene ID | 8600 |
mRNA Refseq | NM_003701 |
Protein Refseq | NP_003692 |
MIM | 602642 |
UniProt ID | O14788 |
◆ Recombinant Proteins | ||
TNFSF11-2650H | Recombinant Human TNFSF11 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
TNFSF11-860MAF647 | Active Recombinant Mouse Tnfsf11 Protein, Fc-tagged, Alexa Fluor 647 conjugated | +Inquiry |
TNFSF11-424H | Recombinant Human TNFSF11, Fc tagged | +Inquiry |
TNFSF11-316H | Recombinant Active Human TNFSF11 Protein, His-tagged(C-ter) | +Inquiry |
TNFSF11-6646H | Recombinant Human TNFSF11 Protein (Ile140-Asp317), N-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNFSF11-001CCL | Recombinant Cynomolgus TNFSF11 cell lysate | +Inquiry |
TNFSF11-1586MCL | Recombinant Mouse TNFSF11 cell lysate | +Inquiry |
TNFSF11-998HCL | Recombinant Human TNFSF11 cell lysate | +Inquiry |
TNFSF11-1093HCL | Recombinant Human TNFSF11 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TNFSF11 Products
Required fields are marked with *
My Review for All TNFSF11 Products
Required fields are marked with *
0
Inquiry Basket