Recombinant Full Length Mouse Tumor Necrosis Factor Ligand Superfamily Member 11(Tnfsf11) Protein, His-Tagged
Cat.No. : | RFL26214MF |
Product Overview : | Recombinant Full Length Mouse Tumor necrosis factor ligand superfamily member 11(Tnfsf11) Protein (O35235) (1-316aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-316) |
Form : | Lyophilized powder |
AA Sequence : | MRRASRDYGKYLRSSEEMGSGPGVPHEGPLHPAPSAPAPAPPPAASRSMFLALLGLGLGQVVCSIALFLYFRAQMDPNRISEDSTHCFYRILRLHENADLQDSTLESEDTLPDSCRRMKQAFQGAVQKELQHIVGPQRFSGAPAMMEGSWLDVAQRGKPEAQPFAHLTINAASIPSGSHKVTLSSWYHDRGWAKISNMTLSNGKLRVNQDGFYYLYANICFRHHETSGSVPTDYLQLMVYVVKTSIKIPSSHNLMKGGSTKNWSGNSEFHFYSINVGGFFKLRAGEEISIQVSNPSLLDPDQDATYFGAFKVQDID |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Tnfsf11 |
Synonyms | Tnfsf11; Opgl; Rankl; Trance; Tumor necrosis factor ligand superfamily member 11; Osteoclast differentiation factor; ODF; Osteoprotegerin ligand; OPGL; Receptor activator of nuclear factor kappa-B ligand; RANKL; TNF-related activation-induced cytokine; TR |
UniProt ID | O35235 |
◆ Recombinant Proteins | ||
TNFSF11-1529H | Recombinant Human TNFSF11 protein, His-tagged | +Inquiry |
Tnfsf11-7835M | Recombinant Mouse Tnfsf11 protein, His & GST-tagged | +Inquiry |
Tnfsf11-6552M | Active Recombinant Mouse Tnfsf11 Protein, His-tagged | +Inquiry |
TNFSF11-1696M | Recombinant Mouse TNFSF11 protein, His-tagged | +Inquiry |
TNFSF11-424H | Recombinant Human TNFSF11, Fc tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNFSF11-001CCL | Recombinant Cynomolgus TNFSF11 cell lysate | +Inquiry |
TNFSF11-1093HCL | Recombinant Human TNFSF11 cell lysate | +Inquiry |
TNFSF11-1586MCL | Recombinant Mouse TNFSF11 cell lysate | +Inquiry |
TNFSF11-998HCL | Recombinant Human TNFSF11 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Tnfsf11 Products
Required fields are marked with *
My Review for All Tnfsf11 Products
Required fields are marked with *
0
Inquiry Basket