Active Recombinant Mouse TNFSF11 Protein

Cat.No. : TNFSF11-255M
Product Overview : Recombinant Mouse TNFSF11 Protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Description : Receptor activator of nuclear factor kappa-B Ligand (RANK Ligand) is a cell-bound marker related to the tumor necrosis factor (TNF) family of proteins. RANK Ligand plays a critical role in bone metabolism and osteoclast differentiation. T cell expression of RANK Ligand promotes dendritic cell maturation.
Bio-activity : Activity of RAW-BlueTM cells , ED50≤50 ng/mL
Molecular Mass : Monomer, 19.5 kDa (175 aa)
AA Sequence : MPAMMEGSWLDVAQRGKPEAQPFAHLTINAASIPSGSHKVTLSSWYHDRGWAKISNMTLSNGKLRVNQDGFYYLYANICFRHHETSGSVPTDYLQLMVYVVKTSIKIPSSHNLMKGGSTKNWSGNSEFHFYSINVGGFFKLRAGEEISIQVSNPSLLDPDQDATYFGAFKVQDID
Endotoxin : ≤1 EUs/μg, Kinetic LAL
Purity : ≥95%, Reducing and Non-Reducing SDS PAGE
Stability : 12 months from date of receipt when stored at -20 to -80 centigrade as supplied.
1 month when stored at 4 centigrade after reconstituting as directed.
3 months when stored at -20 to -80 centigrade after reconstituting as directed.
Storage : Storage Prior to Reconstitution: -20 centigrade
Storage Buffer : Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, 50 mM sodium chloride, pH 7.5
Reconstitution : Sterile water at 0.1 mg/mL
Shipping : Room temperature
Instructions : Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws.
Gene Name Tnfsf11 tumor necrosis factor (ligand) superfamily, member 11 [ Mus musculus (house mouse) ]
Official Symbol TNFSF11
Synonyms TNFSF11; tumor necrosis factor (ligand) superfamily, member 11; tumor necrosis factor ligand superfamily member 11; OPG ligand; osteoprotegerin ligand; osteoclast differentiation factor; receptor activator of NF-kappaB ligand; TNF-related activation-induced cytokine; receptor activator of nuclear factor kappa B ligand; receptor activator of nuclear factor kappa-B ligand; tumor necrosis factor-related activation-induced cytokine; ODF; OPG; OPGL; RANKL; Ly109l; Trance;
Gene ID 21943
mRNA Refseq NM_011613
Protein Refseq NP_035743
UniProt ID O35235

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TNFSF11 Products

Required fields are marked with *

My Review for All TNFSF11 Products

Required fields are marked with *

0
cart-icon
0
compare icon