Active Recombinant Mouse TNFSF11 Protein
Cat.No. : | TNFSF11-255M |
Product Overview : | Recombinant Mouse TNFSF11 Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Description : | Receptor activator of nuclear factor kappa-B Ligand (RANK Ligand) is a cell-bound marker related to the tumor necrosis factor (TNF) family of proteins. RANK Ligand plays a critical role in bone metabolism and osteoclast differentiation. T cell expression of RANK Ligand promotes dendritic cell maturation. |
Bio-activity : | Activity of RAW-BlueTM cells , ED50≤50 ng/mL |
Molecular Mass : | Monomer, 19.5 kDa (175 aa) |
AA Sequence : | MPAMMEGSWLDVAQRGKPEAQPFAHLTINAASIPSGSHKVTLSSWYHDRGWAKISNMTLSNGKLRVNQDGFYYLYANICFRHHETSGSVPTDYLQLMVYVVKTSIKIPSSHNLMKGGSTKNWSGNSEFHFYSINVGGFFKLRAGEEISIQVSNPSLLDPDQDATYFGAFKVQDID |
Endotoxin : | ≤1 EUs/μg, Kinetic LAL |
Purity : | ≥95%, Reducing and Non-Reducing SDS PAGE |
Stability : | 12 months from date of receipt when stored at -20 to -80 centigrade as supplied. 1 month when stored at 4 centigrade after reconstituting as directed. 3 months when stored at -20 to -80 centigrade after reconstituting as directed. |
Storage : | Storage Prior to Reconstitution: -20 centigrade |
Storage Buffer : | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, 50 mM sodium chloride, pH 7.5 |
Reconstitution : | Sterile water at 0.1 mg/mL |
Shipping : | Room temperature |
Instructions : | Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws. |
Gene Name | Tnfsf11 tumor necrosis factor (ligand) superfamily, member 11 [ Mus musculus (house mouse) ] |
Official Symbol | TNFSF11 |
Synonyms | TNFSF11; tumor necrosis factor (ligand) superfamily, member 11; tumor necrosis factor ligand superfamily member 11; OPG ligand; osteoprotegerin ligand; osteoclast differentiation factor; receptor activator of NF-kappaB ligand; TNF-related activation-induced cytokine; receptor activator of nuclear factor kappa B ligand; receptor activator of nuclear factor kappa-B ligand; tumor necrosis factor-related activation-induced cytokine; ODF; OPG; OPGL; RANKL; Ly109l; Trance; |
Gene ID | 21943 |
mRNA Refseq | NM_011613 |
Protein Refseq | NP_035743 |
UniProt ID | O35235 |
◆ Recombinant Proteins | ||
TNFSF11-322H | Active Recombinant Human TNFSF11 protein, mFc-tagged | +Inquiry |
TNFSF11-3253H | Active Recombinant Human TNFSF11 protein(Gly 63-Asp 244), rFc-tagged | +Inquiry |
TNFSF11-8548HF | Recombinant Human TNFSF11 Protein, None-tagged, FITC conjugated | +Inquiry |
Tnfsf11-192M | Recombinant Mouse TNFSF11 | +Inquiry |
TNFSF11-31288TH | Recombinant Human TNFSF11 | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNFSF11-001CCL | Recombinant Cynomolgus TNFSF11 cell lysate | +Inquiry |
TNFSF11-1586MCL | Recombinant Mouse TNFSF11 cell lysate | +Inquiry |
TNFSF11-1093HCL | Recombinant Human TNFSF11 cell lysate | +Inquiry |
TNFSF11-998HCL | Recombinant Human TNFSF11 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TNFSF11 Products
Required fields are marked with *
My Review for All TNFSF11 Products
Required fields are marked with *