"GMPS" Related Products

Expand
Expand

Recombinant Human Guanine Monphosphate Synthetase, His-tagged

Cat. No.: GMPS-1927H
Product Overview: Recombinant humanGMPS protein, fused to His-tag at N-terminus, was expressed in E. coli andpurified by using conventional chromatography techniques.
Description: GMPsynthase, also known as GMPS, is involved in purine biosynthesis. Existing asa homodimer, GMPS catalyzes the last step in the GMP synthesis pathway,namely the ATP-dependent amination of XMP to GMP.
Form: Liquid. In 20mMTris-HCl buffer (pH 8.0) containing 1mM DTT, 30% glycerol, 0.1M NaCl.
Molecular Weight: 79.2 kDa(717aa)
Purity: > 90%by SDS-PAGE
Concentration: 0.5mg/ml (determined by Bradford assay)
Sequences of aminoacids: MGSSHHHHHHSSGLVPRGSH MGSHMALCNG DSKLENAGGD LKDGHHHYEG AVVILDAGAQ YGKVIDRRVRELFVQSEIFP LETPAFAIKE QGFRAIIISG GPNSVYAEDA PWFDPAIFTIGKPVLGICYG MQMMNKVFGG TVHKKSVRED GVFNISVDNT CSLFRGLQKE EVVLLTHGDS VDKVADGFKVVARSGNIVAG IANESKKLYG AQFHPEVGLT ENGKVILKNF LYDIAGCSGT FTVQNRELEC IREIKERVGTSKVLVLLSGGVDSTVCTALLNRALNQEQVI AVHIDNGFMR KRESQSVEEA LKKLGIQVKV INAAHSFYNG TTTLPISDED RTPRKRISKTLNMTTSPEEKRKIIGDTFVKIANEVIGEMN LKPEEVFLAQ GTLRPDLIES ASLVASGKAE LIKTHHNDTE LIRKLREEGK VIEPLKDFHKDEVRILGRELGLPEELVSRHPFPGPGLAIR VICAEEPYIC KDFPETNNIL KIVADFSASV KKPHTLLQRV KACTTEEDQE KLMQITSLHSLNAFLLPIKT VGVQGDCRSY SYVCGISSKD EPDWESLIFL ARLIPRMCHN VNRVVYIFGP PVKEPPTDVTPTFLTTGVLS TLRQADFEAH NILRESGYAG KISQMPVILTPLHFDRDPLQ KQPSCQRSVV IRTFITSDFM TGIPATPGNE IPVEVVLKMV TEIKKIPGIS RIMYDLTSKPPGTTEWE
Storage: Can bestored at +4°C short term (1-2 weeks). For long term storage, aliquot andstore at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Pathways: Drug metabolism-other enzymes; Metabolicpathways; Metabolism; Metabolism of nucleotides; Purine metabolism; Purineribonucleoside monophosphate biosynthesis
Gene Name: GMPS guanine monphosphatesynthetase [ Homo sapiens ]
Official Symbol: GMPS
Synonyms: GMPS; guanine monphosphate synthetase; GMPsynthase [glutamine-hydrolyzing]; GMP synthase; GMP synthetase; MLL/GMPSfusion protein; glutamine amidotransferase; guanosine 5"-monophosphatesynthase; EC 6.3.5.2
Gene ID: 8833
mRNA Refseq: NM_003875
Protein Refseq: NP_003866
MIM: 600358
UniProt ID: P49915
Chromosome Location: 3q24
Function: ATP binding; GMP synthase(glutamine-hydrolyzing) activity; GMP synthase activity; ligase activity;nucleotide binding

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.