Recombinant HPV-6a E5 Protein

• Cat.No.: VAng-Wyb3388
• Product Overview: Recombinant HPV-6a E5 Protein was expressed in E. coli.

Specification

• Species: HPV6a
• Source: E.coli
• Tag: Non
• Form: Lyophilized from 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0.
  The volume before lyophilization is 50μl/vial.
• Molecular Mass: The protein has a calculated MW of 17.8 kDa.
• AA Sequence: MEVVPVQIAAGTTSTLILPVIIAFVVCFVSIILIVWISDFIVYTSVLVLTLLLYLLLWLLLTTPLQFFLLTLLVCYCPALYIHHYIVNTQQ
• Purity: >=85 % by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.