Recombinant Human RAD51B protein, T7/His-tagged
Cat.No. : | RAD51B-121H |
Product Overview : | Recombinant human RAD51B (383aa, Isoform-I, derived from BC030219) fused with T7-His-TEV cleavage site Tag at N-terminal and 11R tag fusion at C-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&T7 |
Protein Length : | 383 a.a. |
Form : | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
AA Sequence : | MASMTGGQQMGRGHHHHHHENLYFQGGEFGSKKLKRVGLSQELCDRLSRHQILTCQDFLCLSPLELMKVTGLSYR GVHELLCMVSRACAPKMQTAYGIKAQRSADFSPAFLSTTLSALDEALHGGVACGSLTEITGPPGCGKTQFCIMMS ILATLPTNMGGLEGAVVYIDTESAFSAERLVEIAESRFPRYFNTEEKLLLTSSKVHLYRELTCDEVLQRIESLEE EIISKGIKLVILDSVASVVRKEFDAQLQGNLKERNKFLAREASSLKYLAEEFSIPVILTNQITTHLSGALASQAD LVSPADDLSLSEGTSGSSCVIAALGNTWSHSVNTRLILQYLDSERRQILIAKSPLAPFTSFVYTIKEEGLVLQET TFCSVTQAELNWAPEILPPQPPEQLGLQMCHHTQLIFLEESGGGGSPGRRRRRRRRRRR |
Purity : | >90% by SDS-PAGE |
Applications : | 1. May be used for in vitro RAD51B mediated double-stranded DNA repair pathway regulation study by intracellular delivery of this protein.2. May be used for RAD51B protein-protein interaction mapping.3. May be used as specific substrate protein for kinase and ubiquitin (Sumo pathway) ralted enzyme functional screening assays.4. As antigen for specific antibody production. |
Storage : | Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days. |
Gene Name | RAD51B RAD51 homolog B (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | RAD51B |
Synonyms | RAD51B; RAD51 homolog B (S. cerevisiae); RAD51 (S. cerevisiae) like 1 , RAD51 like 1 (S. cerevisiae) , RAD51L1; DNA repair protein RAD51 homolog 2; hREC2; R51H2; REC2; RecA-like protein; recombination repair protein; RAD51L1; MGC34245; |
Gene ID | 5890 |
mRNA Refseq | NM_002877 |
Protein Refseq | NP_002868 |
MIM | 602948 |
UniProt ID | O15315 |
Chromosome Location | 14q23-q24.2 |
Pathway | Factors involved in megakaryocyte development and platelet production, organism-specific biosystem; Hemostasis, organism-specific biosystem; Homologous recombination, organism-specific biosystem; Homologous recombination, conserved biosystem; |
Function | ATP binding; DNA binding; DNA-dependent ATPase activity; nucleoside-triphosphatase activity; nucleotide binding; protein binding; |
◆ Recombinant Proteins | ||
RAD51B-121H | Recombinant Human RAD51B protein, T7/His-tagged | +Inquiry |
Rad51b-6781M | Recombinant Mouse Rad51b Protein (Met121-Pro350), N-His tagged | +Inquiry |
RAD51B-12585Z | Recombinant Zebrafish RAD51B | +Inquiry |
RAD51L1-2157H | Recombinant Human RAD51L1 protein, His-tagged | +Inquiry |
RAD51B-2465H | Recombinant human RAD51B, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RAD51B-2554HCL | Recombinant Human RAD51L1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RAD51B Products
Required fields are marked with *
My Review for All RAD51B Products
Required fields are marked with *