Recombinant Full Length Pig Potassium Voltage-Gated Channel Subfamily Kqt Member 1(Kcnq1) Protein, His-Tagged
| Cat.No. : | RFL5060SF |
| Product Overview : | Recombinant Full Length Pig Potassium voltage-gated channel subfamily KQT member 1(KCNQ1) Protein (Q9TTJ7) (1-123aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Case Study
- Application
- Download
| Species : | Sus scrofa (Pig) |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-123) |
| Form : | Lyophilized powder |
| AA Sequence : | IIDLIVVVASMVVLCVGSKGQVFATSAIRGIRFLQILRMLHVDRQGGTWRLLGSVVFIHR QELITTLYIGFLGLIFSSYFVYLAEKDAVNESGQVEFGSYADALWWGVVTVTTIGYGDKV PQT |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | KCNQ1 |
| Synonyms | KCNQ1; KVLQT1; Potassium voltage-gated channel subfamily KQT member 1; IKs producing slow voltage-gated potassium channel subunit alpha KvLQT1; KQT-like 1; Voltage-gated potassium channel subunit Kv7.1 |
| UniProt ID | Q9TTJ7 |
| ◆ Cell & Tissue Lysates | ||
| KCNQ1-5020HCL | Recombinant Human KCNQ1 293 Cell Lysate | +Inquiry |
Case 1: Zhou Y, et al. Gene. 2024
Long noncoding RNA KCNQ1OT1, known for regulating nearby genes in humans, is also found in pigs with a shorter 5' end (about 27 kb). Pig studies show that KCNQ1OT1's knockdown increases CDKN1C expression, yet it doesn't alter the DNA methylation of their promoters. DNA methyltransferase inhibition enhances both KCNQ1OT1 and CDKN1C expression, indicating that their regulation might bypass RNA interference. Chromatin analysis reveals that KCNQ1OT1 binds the CDKN1C promoter, influencing chromosome structure. This interaction influences cumulus cell transformation and early osteogenic differentiation in porcine bone marrow mesenchymal stem cells by upregulating ALPL expression.

Fig1. Decitabine treatment of pFb for 48 h caused double allelic expression of KCNQ1OT1.

Fig2. KCNQ1OT1 lncRNA-DNA interaction detected by real-time PCR in ST cells.
Case 2: Sun J, et al. Cell. 2020
KCNQ1, or Kv7.1, is a voltage-sensitive potassium channel that controls gastric acid production, electrolyte balance, and heart rate. It forms complexes with KCNE subunits to tailor its function across different tissues. In non-excitable cells, KCNQ1 pairs with KCNE3 to prevent channel closure at negative voltages. The lipid PIP2, which initiates pore opening, causes a significant structural shift in KCNQ1, leading to channel activation. This cryo-EM analysis reveals that KCNE3 stabilizes KCNQ1 in a depolarized state, and PIP2 binding induces pore dilation, a mechanism possibly shared by other Kv7 channels.

Fig1. Liposome-based flux assay.

Fig2. SDS-PAGE showing the reconstitution of hKCNQ1EM-KCNE3-CaM complex.
The application of recombinant porcine KCNQ1 protein in daily life is mainly concentrated in medical research, because of its homology with human KCNQ1, it is often used as a research model. Specifically, there are:
Basic research: Pigs are an important model for studying human epigenetics. Studying the expression of KCNQ1OT1 imprinting and its regulatory mechanism in pigs is helpful to understand the epigenetic regulation during cell differentiation and development. Recombinant porcine KCNQ1 protein can be used to study the assembly, function, and regulation of KCNQ1 channels, as well as interactions with non-KCNE partners such as PUFA, PIP2, CaM, and PKA.
Medical research: Dysfunction of KCNQ4 is associated with nonsyndromic autosomal dominant hearing loss. Recombinant porcine KCNQ1 protein may contribute to the study of mechanisms and treatments for hearing loss. In neurons, KCNQ2-KCNQ5 carries an M current that helps maintain the stability of the membrane potential. Recombinant porcine KCNQ1 protein is helpful for the study of neuronal excitability and related neurological diseases. In the heart tissue, KCNQ1 forms a complex with the auxiliary subunit KCNE1 to generate a slow delayed rectification (IKs) current that contributes to the repolarization of the heart action potential. Recombinant porcine KCNQ1 protein can be used in the research and development of drugs to treat heart disease.
Drug development: KCNQ1 is a voltage-gated potassium channel associated with a variety of diseases, such as atrial fibrillation and long QT syndrome. Recombinant porcine KCNQ1 protein can be used to investigate the molecular mechanisms and potential therapeutics of these diseases. The functional properties of the KCNQ1 channel are modulated in a tissue-specific manner by co-assembly with the beta subunit KCNE1-5. Studying the regulatory and gating mechanisms of KCNQ1 is essential for the development of drugs to treat related diseases.

Fig1. KCNQ1-KCNE1 channel complex, where each subunit of KCNQ1 is labeled as 1–4 and S1–S6 helices of KCNQ1 are shown in different colors. (Gunjan Dixit, 2020)
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KCNQ1 Products
Required fields are marked with *
My Review for All KCNQ1 Products
Required fields are marked with *




