"ODC1" Related Products

Expand
Expand
Expand

Recombinant Human ODC1, His-tagged

Cat. No.: ODC1-2498H
Product Overview: Recombinant Human ODC1 (amino acids 1-461) fused with an N terminal His tag, was expressed in E. coli.
Description: This gene encodes the rate-limiting enzyme of the polyamine biosynthesis pathway which catalyzes ornithine to putrescine. The activity level for the enzyme varies in response to growth-promoting stimuli and exhibits a high turnover rate in comparison to other mammalian proteins. Originally localized to both chromosomes 2 and 7, the gene encoding this enzyme has been determined to be located on 2p25, with a pseudogene located on 7q31-qter.
Source: E. coli
Molecular Mass: 53.500kDa inclusive of tags
Protein length: 461 amino acids
Purity: > 95 % by SDS-PAGE
Form: Liquid
Sequence: MGSSHHHHHHSSGLVPRGSHMGSMNNFGNEEFDCHFLDEG FTAKDILDQKINEVSSSDDKDAFYVADLGDILKKHLRWLK ALPRVTPFYAVKCNDSKAIVKTLAATGTGFDCASKTEIQL VQSLGVPPERIIYANPCKQVSQIKYAANNGVQMMTFDSEV ELMKVARAHPKAKLVLRIATDDSKAVCRLSVKFGATLRTS RLLLERAKELNIDVVGVSFHVGSGCTDPETFVQAISDARC VFDMGAEVGFSMYLLDIGGGFPGSEDVKLKFEEITGVINP ALDKYFPSDSGVRIIAEPGRYYVASAFTLAVNIIAKKIVL KEQTGSDDEDESSEQTFMYYVNDGVYGSFNCILYDHAHVK PLLQKRPKPDEKYYSSSIWGPTCDGLDRIVERCDLPEMHV GDWMLFENMGAYTVAAASTFNGFQRPTIYYVMSGPAWQLM QQFQNPDFPPEVEEQDASTLPVSCAWESGMKRHRAACASA SINV
Storagebuffer: pH: 8.00. Constituents: 0.32% Tris HCl, 0.02% DTT, 10% Glycerol, 0.58% Sodium chloride.
Concentration: 50 µg at 0.5 mg/ml
Application: SDS-PAGE
Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
OfficialSymbol: ODC1
Gene Name: ODC1 ornithine decarboxylase 1 [ Homo sapiens ]
Synonyms: ODC1; ornithine decarboxylase 1; ornithine decarboxylase; ODC; EC 4.1.1.17
Gene ID: 4953
mRNA Refseq: NM_002539
Protein Refseq: NP_002530
MIM: 165640
UniProt ID: P11926
Chromosome Location: 2p25
Pathway: Arginine and proline metabolism; Glutathione metabolism; Metabolism; Metabolism of amino acids and derivatives
Function: ornithine decarboxylase activity

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.