"POLK" Related Products

Expand
Expand

Recombinant Human POLK, GST-tagged

Cat.No.: POLK-765H
Product Overview: Human POLK full-length ORF ( AAH50718, 1 a.a. - 472 a.a.) recombinant protein with GST-tag at N-terminal.
Description: External and internal DNA-damaging agents continually threaten the integrity of genetic material in cells. Although a variety of repair mechanisms exist to remove the resulting lesions, some lesions escape repair and block the replication machinery. Members of the Y family of DNA polymerases, such as POLK, permit the continuity of the replication fork by allowing replication through such DNA lesions. Each Y family polymerase has a unique DNA-damage bypass and fidelity profile. POLK is specialized for the extension step of lesion bypass.
Source: wheat germ
Species: Human
Tag: GST
Molecular Mass: 77.66 kDa
AA Sequence: MDSTKEKCDSYKDDLLLRMGLNDNKAGMEGLDKEKINKIIMEATKGSRFYGNELKKEKQVNQRIENMMQQKAQIT SQQLRKAQLQVDRFAMELEQSRNLSNTIVHIDMDAFYAAVEMRDNPELKDKPIAVGSMSMLSTSNYHARRFGVRA AMPGFIAKRLCPQLIIVPPNFDKYRAVSKEVKEILADYDPNFMAMSLDEAYLNITKHLEERQNWPEDKRRYFIKM GSSVENDNPGKEVNKLSEHERSISPLLFEESPSDVQPPGDPFQVNFEEQNNPQILQNSVVFGTSAQEVVKEIRFR IEQKTTLTASAGIAPNTMLAKVCSDKNKPNGQYQILPNRQAVMDFIKDLPIRKVSGIGKVTEKMLKALGIITCTE LYQQRALLSLLFSETSWHYFLHISLGLGSTHLTRDGERKSMSVERTFSEINKAEEQYSLCQELCSELAQDLQKER LKVLYFDMVSLVFKFFNSKMLP
Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot; Antibody Production; Protein Array
Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name: POLK polymerase (DNA directed) kappa [ Homo sapiens (human) ]
Official Symbol: POLK
Synonyms: POLK; DINP; POLQ; DINB1; polymerase (DNA directed) kappa; DNA polymerase kappa; EC 2.7.7.7
Gene ID: 51426
mRNA Refseq: NM_016218
Protein Refseq: NP_057302
MIM: 605650
UniProt ID: Q9UBT6
Chromosome Location: 5q13
Pathway: Fanconi anemia pathway
Function: DNA-directed DNA polymerase activity; damaged DNA binding; metal ion binding

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.