| Cat.No.: | POLK-765H |
| Product Overview: | Human POLK full-length ORF ( AAH50718, 1 a.a. - 472 a.a.) recombinant protein with GST-tag at N-terminal. |
| Description: | External and internal DNA-damaging agents continually threaten the integrity of genetic material in cells. Although a variety of repair mechanisms exist to remove the resulting lesions, some lesions escape repair and block the replication machinery. Members of the Y family of DNA polymerases, such as POLK, permit the continuity of the replication fork by allowing replication through such DNA lesions. Each Y family polymerase has a unique DNA-damage bypass and fidelity profile. POLK is specialized for the extension step of lesion bypass. |
| Source: | wheat germ |
| Species: | Human |
| Tag: | GST |
| Molecular Mass: | 77.66 kDa |
| AA Sequence: | MDSTKEKCDSYKDDLLLRMGLNDNKAGMEGLDKEKINKIIMEATKGSRFYGNELKKEKQVNQRIENMMQQKAQIT SQQLRKAQLQVDRFAMELEQSRNLSNTIVHIDMDAFYAAVEMRDNPELKDKPIAVGSMSMLSTSNYHARRFGVRA AMPGFIAKRLCPQLIIVPPNFDKYRAVSKEVKEILADYDPNFMAMSLDEAYLNITKHLEERQNWPEDKRRYFIKM GSSVENDNPGKEVNKLSEHERSISPLLFEESPSDVQPPGDPFQVNFEEQNNPQILQNSVVFGTSAQEVVKEIRFR IEQKTTLTASAGIAPNTMLAKVCSDKNKPNGQYQILPNRQAVMDFIKDLPIRKVSGIGKVTEKMLKALGIITCTE LYQQRALLSLLFSETSWHYFLHISLGLGSTHLTRDGERKSMSVERTFSEINKAEEQYSLCQELCSELAQDLQKER LKVLYFDMVSLVFKFFNSKMLP |
| Applications: | Enzyme-linked Immunoabsorbent Assay; Western Blot; Antibody Production; Protein Array |
| Storage: | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer: | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name: | POLK polymerase (DNA directed) kappa [ Homo sapiens (human) ] |
| Official Symbol: | POLK |
| Synonyms: | POLK; DINP; POLQ; DINB1; polymerase (DNA directed) kappa; DNA polymerase kappa; EC 2.7.7.7 |
| Gene ID: | 51426 |
| mRNA Refseq: | NM_016218 |
| Protein Refseq: | NP_057302 |
| MIM: | 605650 |
| UniProt ID: | Q9UBT6 |
| Chromosome Location: | 5q13 |
| Pathway: | Fanconi anemia pathway |
| Function: | DNA-directed DNA polymerase activity; damaged DNA binding; metal ion binding |
Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.
Download Datasheet
See All POLK Products
Download Datasheet