"ENTPD1" Related Products

Expand
Expand
Expand

Recombinant Human ENTPD1

Cat.No.: ENTPD1-27578TH
Product Overview: Recombinant full length Human CD39 with N terminal proprietary tag; Predicted MWt 82.17 kDa inclusive of tag.
Description: Ectonucleoside triphosphate diphosphohydrolase 1 (ENTPD1) also known as CD39 (Cluster of Differentiation 39), is a human gene.
Protein length: 510 amino acids
Molecular Weight: 82.170kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Expressed primarily on activated lymphoid cells. Also expressed in endothelial tissues. The vascular isoform and the placental isoform II are present in both placenta and umbilical vein, whereas placental isoform I is present in placenta only.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MEDTKESNVKTFCSKNILAILGFSSIIAVIALLAVGLTQN KALPENVKYGIVLDAGSSHTSLYIYKWPAEKENDTGVVHQ VEECRVKGPGISKFVQKVNEIGIYLTDCMERAREVIPRSQ HQETPVYLGATAGMRLLRMESEELADRVLDVVERSLSNYP FDFQGARIITGQEEGAYGWITINYLLGKFSQKTRWFSIVP YETNNQETFGALDLGGASTQVTFVPQNQTIESPDNALQFR LYGKDYNVYTHSFLCYGKDQALWQKLAKDIQVASNEILRD PCFHPGYKKVVNVSDLYKTPCTKRFEMTLPFQQFEIQGIG NYQQCHQSILELFNTSYCPYSQCAFNGIFLPPLQGDFGAF SAFYFVMKFLNLTSEKVSQEKVTEMMKKFCAQPWEEIKTS YAGVKEKYLSEYCFSGTYILSLLLQGYHFTADSWEHIHFI GKIQGSDAGWTLGYMLNLTNMIPAEQPLSTPLSHSTYVFL MVLFSLVLFTVAIIGLLIFHKPSYFWKDMV
Sequence Similarities: Belongs to the GDA1/CD39 NTPase family.
Gene Name: ENTPD1 ectonucleoside triphosphate diphosphohydrolase 1 [ Homo sapiens ]
Official Symbol: ENTPD1
Synonyms: ENTPD1; ectonucleoside triphosphate diphosphohydrolase 1; CD39; ATPDase; NTPDase 1;
Gene ID: 953
mRNA Refseq: NM_001098175
Protein Refseq: NP_001091645
MIM: 601752
Uniprot ID: P49961
Chromosome Location: 10q23.1-q24.1
Pathway: Purine metabolism, organism-specific biosystem; Purine metabolism, conserved biosystem; Pyrimidine metabolism, organism-specific biosystem; Pyrimidine metabolism, conserved biosystem;
Function: ATP binding; hydrolase activity; nucleoside-diphosphatase activity; nucleoside-triphosphatase activity; nucleotide binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.