"GSTA2" Related Products

Expand
Expand

Recombinant Human GSTA2

Cat.No.: GSTA2-27546TH
Product Overview: Recombinant Full Length Human GSTA2 with 25 kDa proprietary tag produced in Saccharomyces cerevisiae; amino acids 1-222; 222 amino acids, 25.6kDa.
Description: Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. These enzymes function in the detoxification of electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress, by conjugation with glutathione. The genes encoding these enzymes are known to be highly polymorphic. These genetic variations can change an individuals susceptibility to carcinogens and toxins as well as affect the toxicity and efficacy of some drugs. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-tranferase belonging to the alpha class. The alpha class genes, located in a cluster mapped to chromosome 6, are the most abundantly expressed glutathione S-transferases in liver. In addition to metabolizing bilirubin and certain anti-cancer drugs in the liver, the alpha class of these enzymes exhibit glutathione peroxidase activity thereby protecting the cells from reactive oxygen species and the products of peroxidation.
Form: Liquid
Purity: Immunogen affinity purified
Storage buffer: Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MAEKPKLHYSNIRGRMESIRWLLAAAGVEFEEKFIKSAED LDKLRNDGYLMFQQVPMVEIDGMKLVQTRAILNYIASK YNLYGKDIKEKALIDMYIEGIADLGEMILLLPFTQPEE QDAKLALIQEKTKNRYFPAFEKVLKSHGQDYLVGNKLS RADIHLVELLYYVEELDSSLISSFPLLKALKTRISNLP TVKKFLQPGSPRKPPMDEKSLEESRKIFRF
Gene Name: GSTA2 glutathione S-transferase alpha 2 [ Homo sapiens ]
Official Symbol: GSTA2
Synonyms: GSTA2; glutathione S-transferase alpha 2; glutathione S transferase A2 , GST2; glutathione S-transferase A2;
Gene ID: 2939
mRNA Refseq: NM_000846
Protein Refseq: NP_000837
MIM: 138360
Uniprot ID: P09210
Chromosome Location: 6p12.2
Pathway: Biological oxidations, organism-specific biosystem; Drug metabolism - cytochrome P450, organism-specific biosystem; Drug metabolism - cytochrome P450, conserved biosystem; Glutathione conjugation, organism-specific biosystem; Glutathione metabolism, organism-specific biosystem;
Function: glutathione transferase activity; glutathione transferase activity; transferase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.