"GSTM5" Related Products

Expand
Expand
Expand

Recombinant Human GSTM5, GST-tagged

Cat.No.: GSTM5-27772TH
Product Overview: Recombinant full length Human GSTM5 with a N terminal proprietary tag: predicted molecular weight 50.05 kDa.
Description: Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-transferase that belongs to the mu class. The mu class of enzymes functions in the detoxification of electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress, by conjugation with glutathione. The genes encoding the mu class of enzymes are organized in a gene cluster on chromosome 1p13.3 and are known to be highly polymorphic. These genetic variations can change an individuals susceptibility to carcinogens and toxins as well as affect the toxicity and efficacy of certain drugs. Diversification of these genes has occurred in regions encoding substrate-binding domains, as well as in tissue expression patterns, to accommodate an increasing number of foreign compounds.
Protein length: 218 amino acids
Conjugation: GST
Molecular Weight: 50.050kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MPMTLGYWDIRGLAHAIRLLLEYTDSSYVEKKYTLGDAPD YDRSQWLNEKFKLGLDFPNLPYLIDGAHKITQSNAILRYI ARKHNLCGETEEEKIRVDILENQVMDNHMELVRLCYDPDF EKLKPKYLEELPEKLKLYSEFLGKRPWFAGDKITFVDFLA YDVLDMKRIFEPKCLDAFLNLKDFISRFEGLKKISAYMKS SQFLRGLLFGKSATWNSK
Sequence Similarities: Belongs to the GST superfamily. Mu family.Contains 1 GST C-terminal domain.Contains 1 GST N-terminal domain.
Gene Name: GSTM5 glutathione S-transferase mu 5 [ Homo sapiens ]
Official Symbol: GSTM5
Synonyms: GSTM5; glutathione S-transferase mu 5; glutathione S transferase M5; glutathione S-transferase Mu 5;
Gene ID: 2949
mRNA Refseq: NM_000851
Protein Refseq: NP_000842
MIM: 138385
Uniprot ID: P46439
Chromosome Location: 1p13.3
Pathway: Biological oxidations, organism-specific biosystem; Drug metabolism - cytochrome P450, organism-specific biosystem; Drug metabolism - cytochrome P450, conserved biosystem; Glutathione conjugation, organism-specific biosystem; Glutathione metabolism, organism-specific biosystem;
Function: glutathione transferase activity; transferase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.