"KIAA0930" Related Products

Recombinant Human KIAA0930, His-tagged

Cat.No.: KIAA0930-26616TH
Product Overview: Recombinant fragment, corresponding to amino acids 138-404 of Human C22orf9 with N terminal His tag; Predicted MWt 31 kDa.
Description: The function of C22orf9 remains unknown. There are 3 named isoforms produced by alternative splicing.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 138 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: QQVFASPSKHPMDSKGEESKISYPNIFFMIDSFEEVFSDM TVGEGEMVCVELVASDKTNTFQGVIFQGSIRYEALKKV YDNRVSVAARMAQKMSFGFYKYSNMEFVRMKGPQGKGH AEMAVSRVSTGDTSPCGTEEDSSPASPMHERVTSFSTP PTPERNNRPAFFSPSLKRKVPRNRIAEMKKSHSANDSEEF FREDDGGADLHNATNLRSRSLSGTGRSLVGSWLKLNRA DGNFLLYAHLTYVTLPLHRILTDILEVRQKPILMT
Gene Name: KIAA0930 KIAA0930 [ Homo sapiens ]
Official Symbol: KIAA0930
Synonyms: KIAA0930; C22orf9, chromosome 22 open reading frame 9; uncharacterized protein KIAA0930; bK268H5.C22.1;
Gene ID: 23313
mRNA Refseq: NM_015264
Protein Refseq: NP_056079
Uniprot ID: Q6ICG6
Chromosome Location: 22q13.31

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.