"PNLIP" Related Products

Expand
Expand

Recombinant Human PNLIP

Cat.No.: PNLIP-30776TH
Product Overview: Recombinant full length Human Pancreatic Lipase with N terminal proprietary tag; Predicted MWt 77.22 kDa.
Description: This gene is a member of the lipase gene family. It encodes a carboxyl esterase that hydrolyzes insoluble, emulsified triglycerides, and is essential for the efficient digestion of dietary fats. This gene is expressed specifically in the pancreas.
Protein length: 465 amino acids
Molecular Weight: 77.220kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MLPLWTLSLLLGAVAGKEVCYERLGCFSDDSPWSGITERP LHILPWSPKDVNTRFLLYTNENPNNFQEVAADSSSISGSN FKTNRKTRFIIHGFIDKGEENWLANVCKNLFKVESVNCIC VDWKGGSRTGYTQASQNIRIVGAEVAYFVEFLQSAFGYSP SNVHVIGHSLGAHAAGEAGRRTNGTIGRITGLDPAEPCFQ GTPELVRLDPSDAKFVDVIHTDGAPIVPNLGFGMSQVVGH LDFFPNGGVEMPGCKKNILSQIVDIDGIWEGTRDFAACNH LRSYKYYTDSIVNPDGFAGFPCASYNVFTANKCFPCPSGG CPQMGHYADRYPGKTNDVGQKFYLDTGDASNFARWRYKVS VTLSGKKVTGHILVSLFGNKGNSKQYEIFKGTLKPDSTHS NEFDSDVDVGDLQMVKFIWYNNVINPTLPRVGASKIIVET NVGKQFNFCSPETVREEVLLTLTPC
Sequence Similarities: Belongs to the AB hydrolase superfamily. Lipase family.Contains 1 PLAT domain.
Gene Name: PNLIP pancreatic lipase [ Homo sapiens ]
Official Symbol: PNLIP
Synonyms: PNLIP; pancreatic lipase; pancreatic triacylglycerol lipase;
Gene ID: 5406
mRNA Refseq: NM_000936
Protein Refseq: NP_000927
MIM: 246600
Uniprot ID: P16233
Chromosome Location: 10q25.3
Pathway: Acylglycerol degradation, organism-specific biosystem; Acylglycerol degradation, conserved biosystem; Digestion of dietary lipid, organism-specific biosystem; Fat digestion and absorption, organism-specific biosystem; Fat digestion and absorption, conserved biosystem;
Function: hydrolase activity; retinyl-palmitate esterase activity; triglyceride lipase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.