Recombinant Human PPIL3, His-tagged

• Cat.No.: PPIL3-30678TH
• Product Overview: Recombinant full length Human PPIL3 with N terminal His tag; 181 amino acids with a predicted MWt 20.3 kDa including tag.

Specification

• Description: This gene encodes a member of the cyclophilin family. Cyclophilins catalyze the cis-trans isomerization of peptidylprolyl imide bonds in oligopeptides. They have been proposed to act either as catalysts or as molecular chaperones in protein-folding events. Alternative splicing results in multiple transcript variants.
• Protein length: 161 amino acids
• Conjugation: HIS
• Molecular Weight: 20.300kDa inclusive of tags
• Source: E. coli
• Tissue specificity: Ubiquitous. Detected at low levels.
• Form: Liquid
• Purity: >90% by SDS-PAGE
• Storage buffer: pH: 8.00Constituents:0.32% Tris HCl, 0.58% Sodium chloride, 20% Glycerol, 0.02% DTT
• Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMSVTLHTDVGDIKIEVFCER TPKTCENFLALCASNYYNGCIFHRNIKGFMVQTGDPTGTG RGGNSIWGKKFEDEYSEYLKHNVRGVVSMANNGPNTNGSQ FFITYGKQPHLDMKYTVFGKVIDGLETLDELEKLPVNEKT YRPLNDVHIKDITIHANPFAQ
• Sequence Similarities: Belongs to the cyclophilin-type PPIase family. PPIL3 subfamily.Contains 1 PPIase cyclophilin-type domain.

Gene Information

• Gene Name: PPIL3 peptidylprolyl isomerase (cyclophilin)-like 3 [ Homo sapiens ]
• Official Symbol: PPIL3
• Synonyms: PPIL3; peptidylprolyl isomerase (cyclophilin)-like 3; peptidyl-prolyl cis-trans isomerase-like 3; Cyclophilin J; CyPJ
• Gene ID: 53938
• mRNA Refseq: NM_032472
• Protein Refseq: NP_115861
• Uniprot ID: Q9H2H8
• Chromosome Location: 2q33.1
• Function: isomerase activity; peptidyl-prolyl cis-trans isomerase activity; protein binding