"RHOB" Related Products

Expand

Recombinant Human RHOB, His-tagged

Cat.No.: RHOB-27380TH
Product Overview: Recombinant full length Human mature RHOB with an N terminal His tag; 213 amino acids, predicted MWt 23.9kDa.
Description: Mediates apoptosis in neoplastically transformed cells after DNA damage. Not essential for development but affects cell adhesion and growth factor signaling in transformed cells. Plays a negative role in tumorigenesis as deletion causes tumor formation.
Protein length: 193 amino acids
Conjugation: HIS
Molecular Weight: 23.900kDa inclusive of tags
Source: E. coli
Form: Liquid
Purity: >90% by SDS-PAGE
Storage buffer: Preservative: NoneConstituents: 20% Glycerol, 0.2M Sodium chloride, 20mM Tris HCl, 2mM DTT, pH 8.0
Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMAAIRKKLVVVGDGACGKTCLLIVFSKDEFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSVDSPDSLENIPEKWVPEVKHFCPNVPIILVANKKDLRSDEHVRTELARMKQEPVRTDDGRAMAVRIQAYDYLECSAKTKEGVREVFETATRAALQKRYGSQNGCINCC
Sequence Similarities: Belongs to the small GTPase superfamily. Rho family.
Gene Name: RHOB ras homolog gene family, member B [ Homo sapiens ]
Official Symbol: RHOB
Synonyms: RHOB; ras homolog gene family, member B; ARH6, ARHB; rho-related GTP-binding protein RhoB; MST081; oncogene RHO H6; RhoB; RHOH6;
Gene ID: 388
mRNA Refseq: NM_004040
Protein Refseq: NP_004031
MIM: 165370
Uniprot ID: P62745
Chromosome Location: 2p24
Pathway: Axon guidance, organism-specific biosystem; Developmental Biology, organism-specific biosystem; Focal Adhesion, organism-specific biosystem; G alpha (12/13) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem;
Function: GDP binding; GTP binding; GTPase activity; nucleotide binding; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.