Recombinant Human SARNP, His-tagged
Cat.No. : | SARNP-27193TH |
Product Overview : | Recombinant full length protein, corresponding to amino acids 1-210 of Human CIP29 with N terminal His tag, Predicted MWt 25 kDa. |
- Specification
- Gene Information
- Related Products
Description : | This gene encodes a protein that is upregulated in response to various cytokines. The encoded protein may play a role in cell cycle progression. A translocation between this gene and the myeloid/lymphoid leukemia gene, resulting in expression of a chimeric protein, has been associated with acute myelomonocytic leukemia. Pseudogenes exist on chromosomes 7 and 8. Alternatively spliced transcript variants have been described. |
Conjugation : | HIS |
Source : | E. coli |
Form : | Lyophilised:Reconstitute with 112 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MATETVELHKLKLAELKQECLARGLETKGIKQDLIHRLQA YLEEHAEEEANEEDVLGDETEEEETKPIELPVKEEEPP EKTVDVAAEKKVVKITSEIPQTERMQKRAERFNVPVSL ESKKAARAARFGISSVPTKGLSSDNKPMVNLDKLKERA QRFGLNVSSISRKSEDDEKLKKRKERFGIVTSSAGTGTTE DTEAKKRKRAERFGIA |
Gene Name : | SARNP SAP domain containing ribonucleoprotein [ Homo sapiens ] |
Official Symbol : | SARNP |
Synonyms : | SARNP; SAP domain containing ribonucleoprotein; SAP domain-containing ribonucleoprotein; CIP29; cytokine induced protein 29 kDa; Hcc 1; hepatocellular carcinoma 1; THO1; |
Gene ID : | 84324 |
mRNA Refseq : | NM_033082 |
Protein Refseq : | NP_149073 |
MIM : | 610049 |
Uniprot ID : | P82979 |
Chromosome Location : | 12q13.2 |
Function : | DNA binding; RNA binding; RS domain binding; nucleic acid binding; protein C-terminus binding; |
Products Types
◆ Recombinant Protein | ||
SARNP-4889R | Recombinant Rat SARNP Protein, His (Fc)-Avi-tagged | +Inquiry |
SARNP-1370H | Recombinant Human SARNP Protein, GST-tagged | +Inquiry |
SARNP-2978C | Recombinant Chicken SARNP | +Inquiry |
SARNP-3011Z | Recombinant Zebrafish SARNP | +Inquiry |
SARNP-5230R | Recombinant Rat SARNP Protein | +Inquiry |
◆ Lysates | ||
SARNP-2062HCL | Recombinant Human SARNP 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket