Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human SERPINB3

Cat.No. : SERPINB3-31163TH
Product Overview : Recombinant fragment of Human SerpinB3 protein with an N terminal proprietary tag; predicted mwt: 38.28 kDa inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
Description : Serpin B3 is a protein that in humans is encoded by the SERPINB3 gene.
Protein length : 115 amino acids
Molecular Weight : 38.280kDa inclusive of tags
Source : Wheat germ
Tissue specificity : Squamous cells. Expressed in some hepatocellular carcinoma (at protein level).
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : RETRVDLHLPRFKVEESYDLKDTLRTMGMVDIFNGDADLS GMTGSRGLVLSGVLHKAFVEVTEEGAEAAAATAVVGFGSS PTSTNEEFHCNHPFLFFIRQNKTNSILFYGRFSSP
Sequence Similarities : Belongs to the serpin family. Ov-serpin subfamily.
Gene Name : SERPINB3 serpin peptidase inhibitor, clade B (ovalbumin), member 3 [ Homo sapiens ]
Official Symbol : SERPINB3
Synonyms : SERPINB3; serpin peptidase inhibitor, clade B (ovalbumin), member 3; SCC, SCCA1, serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 3; serpin B3; HsT1196; T4 A;
Gene ID : 6317
mRNA Refseq : NM_006919
Protein Refseq : NP_008850
MIM : 600517
Uniprot ID : P29508
Chromosome Location : 18q21.3
Pathway : Amoebiasis, organism-specific biosystem; Amoebiasis, conserved biosystem;
Function : peptidase inhibitor activity; serine-type endopeptidase inhibitor activity;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends