Recombinant Human SNRPA1, His-tagged
Cat.No. : | SNRPA1-29599TH |
Product Overview : | Recombinant full length Human SNRPA1 with N terminal His tag; 275 amino acids with tag, Predicted MWt 30.5 kDa. |
- Specification
- Gene Information
- Related Products
Description : | SNRPA1, also known as U2 small nuclear ribonucleoprotein A, is a component of the U2 snRNP that forms a complex with U2 snRNP B (U2B). Together, U2 snRNP A and U2 snRNP B form a complex that binds to the U2 snRNA hairpin IV. |
Protein length : | 255 amino acids |
Conjugation : | HIS |
Molecular Weight : | 30.500kDa inclusive of tags |
Source : | E. coli |
Form : | Liquid |
Purity : | by SDS-PAGE |
Storage buffer : | pH: 8.00Constituents:0.32% Tris HCl, 30% Glycerol, 1.17% Sodium chloride, 0.03% DTT, 0.002% PMSF |
Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMVKLTAELIEQAAQYTNAVR DRELDLRGYKIPVIENLGATLDQFDAIDFSDNEIRKLDGF PLLRRLKTLLVNNNRICRIGEGLDQALPCLTELILTNNSL VELGDLDPLASLKSLTYLSILRNPVTNKKHYRLYVIYKVP QVRVLDFQKVKLKERQEAEKMFKGKRGAQLAKDIARRSKT FNPGAGLPTDKKKGGPSPGDVEAIKNAIANASTLAEVERL KGLLQSGQIPGRERRSGPTDDGEEEMEEDTVTNGS |
Sequence Similarities : | Belongs to the U2 small nuclear ribonucleoprotein A family.Contains 4 LRR (leucine-rich) repeats.Contains 1 LRRCT domain. |
Gene Name : | SNRPA1 small nuclear ribonucleoprotein polypeptide A [ Homo sapiens ] |
Official Symbol : | SNRPA1 |
Synonyms : | SNRPA1; small nuclear ribonucleoprotein polypeptide A; U2 small nuclear ribonucleoprotein A; Lea1; |
Gene ID : | 6627 |
mRNA Refseq : | NM_003090 |
Protein Refseq : | NP_003081 |
MIM : | 603521 |
Uniprot ID : | P09661 |
Chromosome Location : | 15q26.3 |
Pathway : | Formation and Maturation of mRNA Transcript, organism-specific biosystem; Gene Expression, organism-specific biosystem; Processing of Capped Intron-Containing Pre-mRNA, organism-specific biosystem; Spliceosome, organism-specific biosystem; Spliceosome, conserved biosystem; |
Function : | RNA binding; protein binding; |
Products Types
◆ Recombinant Protein | ||
Snrpa-2088M | Recombinant Mouse Snrpa Protein, His-tagged | +Inquiry |
Snrpa-6004M | Recombinant Mouse Snrpa Protein, Myc/DDK-tagged | +Inquiry |
SNRPA1-694C | Recombinant Cynomolgus Monkey SNRPA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
SNRPA1-4191R | Recombinant Rhesus Macaque SNRPA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
SNRPA-2252H | Recombinant Human SNRPA Protein, MYC/DDK-tagged | +Inquiry |
◆ Lysates | ||
SNRPA-1619HCL | Recombinant Human SNRPA 293 Cell Lysate | +Inquiry |
SNRPA1-1618HCL | Recombinant Human SNRPA1 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket