"SPINT1" Related Products

Expand
Expand

Recombinant Human SPINT1

Cat.No.: SPINT1-29310TH
Product Overview: Recombinant full length Human HGFA Inhibitor 1 with N-terminal proprietary tag. Predicted MW 82.5kDa.
Description: The protein encoded by this gene is a member of the Kunitz family of serine protease inhibitors. The protein is a potent inhibitor specific for HGF activator and is thought to be involved in the regulation of the proteolytic activation of HGF in injured tissues. Alternative splicing results in multiple variants encoding different isoforms.
Protein length: 513 amino acids
Molecular Weight: 82.500kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MAPARTMARARLAPAGIPAVALWLLCTLGLQGTQAGPPPA PPGLPAGADCLNSFTAGVPGFVLDTNASVSNGATFLESPT VRRGWDCVRACCTTQNCNLALVELQPDRGEDAIAACFLIN CLYEQNFVCKFAPREGFINYLTREVYRSYRQLRTQGFGGS GIPKAWAGIDLKVQPQEPLVLKDVENTDWRLLRGDTDVRV ERKDPNQVELWGLKEGTYLFQLTVTSSDHPEDTANVTVTV LSTKQTEDYCLASNKVGRCRGSFPRWYYDPTEQICKSFVY GGCLGNKNNYLREEECILACRGVQGPSMERRHPVCSGTCQ PTQFRCSNGCCIDSFLECDDTPNCPDASDEAACEKYTSGF DELQRIHFPSDKGHCVDLPDTGLCKESIPRWYYNPFSEHC ARFTYGGCYGNKNNFEEEQQCLESCRGISKKDVFGLRREI PIPSTGSVEMAVAVFLVICIVVVVAILGYCFFKNQRKDFH GHHHHPPPTPASSTVSTTEDTEHLVYNHTTRPL
Sequence Similarities: Contains 2 BPTI/Kunitz inhibitor domains.Contains 1 LDL-receptor class A domain.Contains 1 MANSC domain.
Gene Name: SPINT1 serine peptidase inhibitor, Kunitz type 1 [ Homo sapiens ]
Official Symbol: SPINT1
Synonyms: SPINT1; serine peptidase inhibitor, Kunitz type 1; serine protease inhibitor, Kunitz type 1; kunitz-type protease inhibitor 1; HAI; MANSC2;
Gene ID: 6692
mRNA Refseq: NM_001032367
Protein Refseq: NP_001027539
MIM: 605123
Uniprot ID: O43278
Chromosome Location: 15q13.3
Pathway: Transcriptional misregulation in cancers, organism-specific biosystem; Transcriptional misregulation in cancers, conserved biosystem;
Function: peptidase inhibitor activity; serine-type endopeptidase inhibitor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.