Cat.No. : |
TAGLN-30926TH |
Product Overview : |
Recombinant fragment, corresponding to amino acids 4-201 of Human SM22 alpha with N terminal His tag; 198 amino acids, 26kDa. |
Description : |
The protein encoded by this gene is a transformation and shape-change sensitive actin cross-linking/gelling protein found in fibroblasts and smooth muscle. Its expression is down-regulated in many cell lines, and this down-regulation may be an early and sensitive marker for the onset of transformation. A functional role of this protein is unclear. Two transcript variants encoding the same protein have been found for this gene. |
Conjugation : |
HIS |
Source : |
E. coli |
Form : |
Lyophilised:Reconstitute with 115 μl aqua dest. |
Storage buffer : |
Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : |
Store at 4°C. Upon reconstitution store at -80oC. |
Sequences of amino acids : |
KGPSYGMSREVQSKIEKKYDEELEERLVEWIIVQCGPDVG RPDRGRLGFQVWLKNGVILSKLVNSLYPDGSKPVKVPE NPPSMVFKQMEQVAQFLKAAEDYGVIKTDMFQTVDLFEGK DMAAVQRTLMALGSLAVTKNDGHYRGDPNWFMKKAQEH KREFTESQLQEGKHVIGLQMGSNRGASQAGMTGYGRPR QIIS |
Sequence Similarities : |
Belongs to the calponin family.Contains 1 calponin-like repeat.Contains 1 CH (calponin-homology) domain. |