Recombinant Human TAGLN, His-tagged
Cat.No. : | TAGLN-30926TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 4-201 of Human SM22 alpha with N terminal His tag; 198 amino acids, 26kDa. |
- Specification
- Gene Information
- Related Products
Description : | The protein encoded by this gene is a transformation and shape-change sensitive actin cross-linking/gelling protein found in fibroblasts and smooth muscle. Its expression is down-regulated in many cell lines, and this down-regulation may be an early and sensitive marker for the onset of transformation. A functional role of this protein is unclear. Two transcript variants encoding the same protein have been found for this gene. |
Conjugation : | HIS |
Source : | E. coli |
Form : | Lyophilised:Reconstitute with 115 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Store at 4°C. Upon reconstitution store at -80oC. |
Sequences of amino acids : | KGPSYGMSREVQSKIEKKYDEELEERLVEWIIVQCGPDVG RPDRGRLGFQVWLKNGVILSKLVNSLYPDGSKPVKVPE NPPSMVFKQMEQVAQFLKAAEDYGVIKTDMFQTVDLFEGK DMAAVQRTLMALGSLAVTKNDGHYRGDPNWFMKKAQEH KREFTESQLQEGKHVIGLQMGSNRGASQAGMTGYGRPR QIIS |
Sequence Similarities : | Belongs to the calponin family.Contains 1 calponin-like repeat.Contains 1 CH (calponin-homology) domain. |
Gene Name : | TAGLN transgelin [ Homo sapiens ] |
Official Symbol : | TAGLN |
Synonyms : | TAGLN; transgelin; DKFZp686P11128; SM22; SM22 alpha; SMCC; TAGLN1; transgelin variant 2; WS3 10; |
Gene ID : | 6876 |
mRNA Refseq : | NM_001001522 |
Protein Refseq : | NP_001001522 |
MIM : | 600818 |
Uniprot ID : | Q01995 |
Chromosome Location : | 11q23.2 |
Function : | actin binding; |
Products Types
◆ Recombinant Protein | ||
Tagln-6284M | Recombinant Mouse Tagln Protein, Myc/DDK-tagged | +Inquiry |
TAGLN-8978M | Recombinant Mouse TAGLN Protein, His (Fc)-Avi-tagged | +Inquiry |
TAGLN-5578R | Recombinant Rat TAGLN Protein, His (Fc)-Avi-tagged | +Inquiry |
TAGLN-744C | Recombinant Cynomolgus Monkey TAGLN Protein, His (Fc)-Avi-tagged | +Inquiry |
TAGLN-5148H | Recombinant Human TAGLN protein, GST-tagged | +Inquiry |
◆ Lysates | ||
TAGLN-1263HCL | Recombinant Human TAGLN 293 Cell Lysate | +Inquiry |
TAGLN-1262HCL | Recombinant Human TAGLN 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket