Recombinant Human Amyloid-Beta 1-40 Protein, 13C, 15N Label
Cat.No. : | ABNC-307H |
Product Overview : | Recombinant Human Amyloid-Beta 1-40 Protein, 13C, 15N Uniform Label is expressed in Escherichia coli using 15NH4-Cl as sole nitrogen source and 13C glucose as sole carbon source. Between 95-99% isotope incorporation. Counter Ion: Ammonium Acetate. |
- Specification
- Gene Information
- Related Products
Source : | E. coli |
Species : | Human |
Form : | Lyophilized |
AA Sequence : | DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV |
Purity : | > 95% HPLC and SDS-PAGE |
Storage : | Store at -20 centigrade upon arrival. |
Reconstitution : | It is importance to follow our recommendations of solubilisation: To efficiently solubilise the amyloid β-peptide (1-40) the pH should briefly be raised to between 11-12. This can be accomplished by 20 mM of NaOH, however, at high peptide concentrations a higher NaOH concentration may be required due to the intrinsic buffering capacity of the peptide. The pH should therefore always be monitored and if necessary adjusted. After solubilisation the pH can be adjusted using the buffer of choice. |
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket