"MS4A1" Related Products

Expand
Expand
Expand

Recombinant Human MS4A1

Cat. No.: MS4A1-11H
Product Overview: Recombinant Human MS4A1 encoding human MS4A1 full-length ORFproduced in in vitro wheat germ expression system with proprietary liposome technology.
Description: This gene encodes a member of the membrane-spanning 4A gene family. Members of this nascent protein family are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns among hematopoietic cells and nonlymphoid tissues. This gene encodes a B-lymphocyte surface molecule which plays a role in the development and differentiation of B-cells into plasma cells. This family member is localized to 11q12, among a cluster of family members. Alternative splicing of this gene results in two transcript variants which encode the same protein.
Source: wheat germ
Sequence: MTTPRNSVNGTFPAEPMKGPIAMQSGPKPLFRRMSSLVGPTQSFFMRES KTLGAVQIMNGLFHIALGGLLMIPAGIYAPICVTVWYPLWGGIMYIISGSLLAA TEKNSRKCLVKGKMIMNSLSLFAAISGMILSIMDILNIKISHFLKMESLNFIRA HTPYINIYNCEPANPSEKNSPSTQYCYSIQSLFLGILSVMLIFAFFQELVIAGI VENEWKRTCSRPKSNIVLLSAEEKKEQTIEIKEEVVGLTETSSQPKNEEDI EIIPIQEEEEEETETNFPEPPQDQESSPIENDSSP
MolecularWeight: 33.1kDa
Storage Buffer: 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.