"DECR1" Related Products

Expand
Expand

Recombinant Human DECR1, His-tagged

Cat. No.: DECR1-972H
Product Overview: Recombinanthuman DECR1 with his tag was expressed in E.coli and purified by conventional chromatography, 34.4 kDa(35 a.a. - 335 a.a.).
Description: This geneencodes an accessory enzyme which participates in the beta-oxidation andmetabolism of unsaturated fatty enoyl-CoA esters.
Source: E.coli
Species: Human
Amino Acid Sequence: MGSSHHHHHHSSGLVPRGSHMNTEALQSKFFSPLQKAMLPPNSFQGKVAFITGGGTGLGKGMTTLLSSLGAQCVIASRKMDVLKATAEQISSQTGNK VHAIQCDVRDPDMVQNTVSELIKVAGHPNIVINNAAGNFISPTERLSPNAWKTITDIVLNGTAFVTLEIGKQLIKAQKGAAFLSITTIYAETGSGFVVPSASAK AGVEAMSKSLAAEWGKYGMRFNVIQPGPIKTKGAFSRLDPTGTFEKEMIGRIPCGRLGTVEELANLAAFLCSDYASWINGAVIKFDGGEEVLISGEFNDL RKVTKEQWDTIEELIRKTKGS
Form: Liquid
Concentration: 1 mg/mL
Purity: > 90% by SDS-PAGE
Applications: SDS-PAGE
StorageBuffer: In 20 mM Tris-HCl, pH 8.0(10% glycerol, 1 mMdithiothreitol)
Storage: Store at4°C for 1-2 weeks. For long term storage store at -20°C or -80°C. Aliquot toavoid repeated freezing and thawing.
OfficialSymbol: DECR1
Gene Name: DECR1 2,4-dienoyl CoA reductase1, mitochondrial [Homo sapiens]
Synonyms: DECR1; DECR; NADPH;SDR18C1; 2,4-dienoyl CoA reductase 1, mitochondrial; 2,4-dienoyl-CoAreductase, mitochondrial;4-enoyl-CoA reductase;short chaindehydrogenase/reductase family 18C, member 1; 4-enoyl-CoA reductase [NADPH];EC1.3.1.34; 2,4-dienoyl-CoA reductase [NADPH]
Gene ID: 1666
mRNA Refseq: NM_001359
Protein Refseq: NP_001350
MIM: 222745
UniProt ID: Q16698
Chromosome Location: 8q21.3
Pathway: Fatty Acid BetaOxidation; Fatty Acid Biosynthesis; Fatty acid
Function: 2,4-dienoyl-CoA reductase (NADPH) activity; NADPH binding; nucleotidebinding

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.