"DECR1" Related Products

Expand
Expand

Recombinant Human DECR1, His-tagged

Cat. No.: DECR1-972H
Product Overview: Recombinanthuman DECR1 with his tag was expressed in E.coli and purified by conventional chromatography, 34.4 kDa(35 a.a. - 335 a.a.).
Description: This geneencodes an accessory enzyme which participates in the beta-oxidation andmetabolism of unsaturated fatty enoyl-CoA esters.
Source: E.coli
Species: Human
Amino Acid Sequence: MGSSHHHHHHSSGLVPRGSHMNTEALQSKFFSPLQKAMLPPNSFQGKVAFITGGGTGLGKGMTTLLSSLGAQCVIASRKMDVLKATAEQISSQTGNK VHAIQCDVRDPDMVQNTVSELIKVAGHPNIVINNAAGNFISPTERLSPNAWKTITDIVLNGTAFVTLEIGKQLIKAQKGAAFLSITTIYAETGSGFVVPSASAK AGVEAMSKSLAAEWGKYGMRFNVIQPGPIKTKGAFSRLDPTGTFEKEMIGRIPCGRLGTVEELANLAAFLCSDYASWINGAVIKFDGGEEVLISGEFNDL RKVTKEQWDTIEELIRKTKGS
Form: Liquid
Concentration: 1 mg/mL
Purity: > 90% by SDS-PAGE
Applications: SDS-PAGE
StorageBuffer: In 20 mM Tris-HCl, pH 8.0(10% glycerol, 1 mMdithiothreitol)
Storage: Store at4°C for 1-2 weeks. For long term storage store at -20°C or -80°C. Aliquot toavoid repeated freezing and thawing.
OfficialSymbol: DECR1
Gene Name: DECR1 2,4-dienoyl CoA reductase1, mitochondrial [Homo sapiens]
Synonyms: DECR1; DECR; NADPH;SDR18C1; 2,4-dienoyl CoA reductase 1, mitochondrial; 2,4-dienoyl-CoAreductase, mitochondrial;4-enoyl-CoA reductase;short chaindehydrogenase/reductase family 18C, member 1; 4-enoyl-CoA reductase [NADPH];EC1.3.1.34; 2,4-dienoyl-CoA reductase [NADPH]
Gene ID: 1666
mRNA Refseq: NM_001359
Protein Refseq: NP_001350
MIM: 222745
UniProt ID: Q16698
Chromosome Location: 8q21.3
Pathway: Fatty Acid BetaOxidation; Fatty Acid Biosynthesis; Fatty acid
Function: 2,4-dienoyl-CoA reductase (NADPH) activity; NADPH binding; nucleotidebinding

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.