Recombinant Human DECR1, His-tagged

Cat.No. : DECR1-26259TH
Product Overview : Recombinant full length Human DECR1 with N terminal His tag; 322 amino acids with tag, MWt 34.4 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 301 amino acids
Description : This gene encodes an accessory enzyme which participates in the beta-oxidation and metabolism of unsaturated fatty enoyl-CoA esters.
Conjugation : HIS
Molecular Weight : 34.400kDa inclusive of tags
Tissue specificity : Heart = liver = pancreas >kidney >>skeletal muscle = lung.
Form : Liquid
Purity : >90% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 10% Glycerol, 20mM Tris HCl, 1mM DTT, pH 8.0
Storage : Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHM NTEALQSKFFSPLQKAMLPPNSFQGKVAFITGGGTGLGKGMTTLLSSLGAQCVIASRKMDVLKATAEQISSQTGNKVHAIQCDVRDPDMVQNTVSELIKVAGHPNIVINNAAGNFISPTERLSPNAWKTITDIVLNGTAFVTLEIGKQLIKAQKGAAFLSITTIYAETGSGFVVPSASAKAGVEAMSKSLAAEWGKYGMRFNVIQPGPIKTKGAFSRLDPTGTFEKEMIGRIPCGRLGTVEELANLAAFLCSDYASWINGAVIKFDGGEEVLISGEFNDLRKVTKEQWDTIEELIRKTKGS
Sequence Similarities : Belongs to the short-chain dehydrogenases/reductases (SDR) family. 2,4-dienoyl-CoA reductase subfamily.
Gene Name DECR1 2,4-dienoyl CoA reductase 1, mitochondrial [ Homo sapiens ]
Official Symbol DECR1
Synonyms DECR1; 2,4-dienoyl CoA reductase 1, mitochondrial; DECR; 2,4-dienoyl-CoA reductase, mitochondrial; SDR18C1; short chain dehydrogenase/reductase family 18C; member 1;
Gene ID 1666
mRNA Refseq NM_001359
Protein Refseq NP_001350
Uniprot ID Q16698
Chromosome Location 8q21.3
Pathway Fatty Acid Beta Oxidation, organism-specific biosystem; Fatty Acid Biosynthesis, organism-specific biosystem; Fatty acid, triacylglycerol, and ketone body metabolism, organism-specific biosystem; Metabolism of lipids and lipoproteins, organism-specific biosystem; Mitochondrial Fatty Acid Beta-Oxidation, organism-specific biosystem;
Function 2,4-dienoyl-CoA reductase (NADPH) activity; 2,4-dienoyl-CoA reductase (NADPH) activity; NADPH binding; nucleotide binding; oxidoreductase activity, acting on NADH or NADPH;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DECR1 Products

Required fields are marked with *

My Review for All DECR1 Products

Required fields are marked with *

0
cart-icon