Recombinant Human DECR1, His-tagged

• Cat.No.: DECR1-26259TH
• Product Overview: Recombinant full length Human DECR1 with N terminal His tag; 322 amino acids with tag, MWt 34.4 kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 301 amino acids
• Description: This gene encodes an accessory enzyme which participates in the beta-oxidation and metabolism of unsaturated fatty enoyl-CoA esters.
• Conjugation: HIS
• Molecular Weight: 34.400kDa inclusive of tags
• Tissue specificity: Heart = liver = pancreas >kidney >>skeletal muscle = lung.
• Form: Liquid
• Purity: >90% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 10% Glycerol, 20mM Tris HCl, 1mM DTT, pH 8.0
• Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHM NTEALQSKFFSPLQKAMLPPNSFQGKVAFITGGGTGLGKGMTTLLSSLGAQCVIASRKMDVLKATAEQISSQTGNKVHAIQCDVRDPDMVQNTVSELIKVAGHPNIVINNAAGNFISPTERLSPNAWKTITDIVLNGTAFVTLEIGKQLIKAQKGAAFLSITTIYAETGSGFVVPSASAKAGVEAMSKSLAAEWGKYGMRFNVIQPGPIKTKGAFSRLDPTGTFEKEMIGRIPCGRLGTVEELANLAAFLCSDYASWINGAVIKFDGGEEVLISGEFNDLRKVTKEQWDTIEELIRKTKGS
• Sequence Similarities: Belongs to the short-chain dehydrogenases/reductases (SDR) family. 2,4-dienoyl-CoA reductase subfamily.

Gene Information

• Gene Name: DECR1 2,4-dienoyl CoA reductase 1, mitochondrial [ Homo sapiens ]
• Official Symbol: DECR1
• Synonyms: DECR1; 2,4-dienoyl CoA reductase 1, mitochondrial; DECR; 2,4-dienoyl-CoA reductase, mitochondrial; SDR18C1; short chain dehydrogenase/reductase family 18C; member 1
• Gene ID: 1666
• mRNA Refseq: NM_001359
• Protein Refseq: NP_001350
• Uniprot ID: Q16698
• Chromosome Location: 8q21.3
• Pathway: Fatty Acid Beta Oxidation, organism-specific biosystem; Fatty Acid Biosynthesis, organism-specific biosystem; Fatty acid, triacylglycerol, and ketone body metabolism, organism-specific biosystem; Metabolism of lipids and lipoproteins, organism-specific biosystem; Mitochondrial Fatty Acid Beta-Oxidation, organism-specific biosystem
• Function: 2,4-dienoyl-CoA reductase (NADPH) activity; 2,4-dienoyl-CoA reductase (NADPH) activity; NADPH binding; nucleotide binding; oxidoreductase activity, acting on NADH or NADPH