Recombinant Human DECR1, His-tagged
Cat.No. : | DECR1-26259TH |
Product Overview : | Recombinant full length Human DECR1 with N terminal His tag; 322 amino acids with tag, MWt 34.4 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 301 amino acids |
Description : | This gene encodes an accessory enzyme which participates in the beta-oxidation and metabolism of unsaturated fatty enoyl-CoA esters. |
Conjugation : | HIS |
Molecular Weight : | 34.400kDa inclusive of tags |
Tissue specificity : | Heart = liver = pancreas >kidney >>skeletal muscle = lung. |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 10% Glycerol, 20mM Tris HCl, 1mM DTT, pH 8.0 |
Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHM NTEALQSKFFSPLQKAMLPPNSFQGKVAFITGGGTGLGKGMTTLLSSLGAQCVIASRKMDVLKATAEQISSQTGNKVHAIQCDVRDPDMVQNTVSELIKVAGHPNIVINNAAGNFISPTERLSPNAWKTITDIVLNGTAFVTLEIGKQLIKAQKGAAFLSITTIYAETGSGFVVPSASAKAGVEAMSKSLAAEWGKYGMRFNVIQPGPIKTKGAFSRLDPTGTFEKEMIGRIPCGRLGTVEELANLAAFLCSDYASWINGAVIKFDGGEEVLISGEFNDLRKVTKEQWDTIEELIRKTKGS |
Sequence Similarities : | Belongs to the short-chain dehydrogenases/reductases (SDR) family. 2,4-dienoyl-CoA reductase subfamily. |
Gene Name | DECR1 2,4-dienoyl CoA reductase 1, mitochondrial [ Homo sapiens ] |
Official Symbol | DECR1 |
Synonyms | DECR1; 2,4-dienoyl CoA reductase 1, mitochondrial; DECR; 2,4-dienoyl-CoA reductase, mitochondrial; SDR18C1; short chain dehydrogenase/reductase family 18C; member 1; |
Gene ID | 1666 |
mRNA Refseq | NM_001359 |
Protein Refseq | NP_001350 |
Uniprot ID | Q16698 |
Chromosome Location | 8q21.3 |
Pathway | Fatty Acid Beta Oxidation, organism-specific biosystem; Fatty Acid Biosynthesis, organism-specific biosystem; Fatty acid, triacylglycerol, and ketone body metabolism, organism-specific biosystem; Metabolism of lipids and lipoproteins, organism-specific biosystem; Mitochondrial Fatty Acid Beta-Oxidation, organism-specific biosystem; |
Function | 2,4-dienoyl-CoA reductase (NADPH) activity; 2,4-dienoyl-CoA reductase (NADPH) activity; NADPH binding; nucleotide binding; oxidoreductase activity, acting on NADH or NADPH; |
◆ Recombinant Proteins | ||
DECR1-972H | Recombinant Human DECR1, His-tagged | +Inquiry |
DECR1-26259TH | Recombinant Human DECR1, His-tagged | +Inquiry |
DECR1-971H | Recombinant Human 2,4-Dienoyl-CoA Reductase, Mitochondrial, His-tagged | +Inquiry |
DECR1-576Z | Recombinant Zebrafish DECR1 | +Inquiry |
DECR1-26H | Recombinant Human DECR1 protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DECR1-6997HCL | Recombinant Human DECR1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DECR1 Products
Required fields are marked with *
My Review for All DECR1 Products
Required fields are marked with *