"Vegfa" Related Products

Recombinant Mouse Vegfa protein

Cat.No.: Vegfa-18M
Product Overview: Recombinant Mouse Vegfa(Ala27-Arg190) was expressed in Pichia pastoris.
Source: Pichia pastoris
Species: Mouse
Form: Lyophilized from a 0.2 μm filtered solution of PBS,pH 7.4
Protein length: Ala27-Arg190
AA Sequence: APTTEGEQKSHEVIKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEAL ECVPTSESNITMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPENHCEPCSERRKHLFVQD PQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Endotoxin: Less than 0.1 ng/µg (1 IEU/µg).
Purity: Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Storage: Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days.Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months.
Reconstitution: Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in 1X PBS.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Shipping: The product is shipped at ambient temperature.
Gene Name: Vegfa vascular endothelial growth factor A [ Mus musculus ]
Official Symbol: Vegfa
Synonyms: VEGFA; vascular endothelial growth factor A; vascular permeability factor; Vpf; Vegf; Vegf120; Vegf164; Vegf188;
Gene ID: 22339
mRNA Refseq: NM_001025250
Protein Refseq: NP_001020421
MIM:
UniProt ID: Q00731
Chromosome Location: 17 C; 17 22.79 Cm
Pathway: Bladder cancer, organism-specific biosystem; Bladder cancer, conserved biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Endochondral Ossification, organism-specific biosystem; Focal Adhesion, organism-specific biosystem; Focal adhesion, organism-specific biosystem;
Function: cell surface binding; chemoattractant activity; cytokine activity; fibronectin binding; growth factor activity; heparin binding; platelet-derived growth factor receptor binding; protein heterodimerization activity; protein homodimerization activity; receptor agonist activity; vascular endothelial growth factor receptor 1 binding; vascular endothelial growth factor receptor 2 binding; vascular endothelial growth factor receptor binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.