"Vegfa" Related Products

Recombinant Mouse Vegfa protein

Cat.No. : Vegfa-18M
Product Overview : Recombinant Mouse Vegfa(Ala27-Arg190) was expressed in Pichia pastoris.
Source : Pichia pastoris
Species : Mouse
Form : Lyophilized from a 0.2 μm filtered solution of PBS,pH 7.4
Protein length : Ala27-Arg190
AA Sequence : APTTEGEQKSHEVIKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEAL ECVPTSESNITMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPENHCEPCSERRKHLFVQD PQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg).
Purity : Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Storage : Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days.Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months.
Reconstitution : Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in 1X PBS.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Shipping : The product is shipped at ambient temperature.
Gene Name : Vegfa vascular endothelial growth factor A [ Mus musculus ]
Official Symbol : Vegfa
Synonyms : VEGFA; vascular endothelial growth factor A; vascular permeability factor; Vpf; Vegf; Vegf120; Vegf164; Vegf188;
Gene ID : 22339
mRNA Refseq : NM_001025250
Protein Refseq : NP_001020421
MIM :
UniProt ID : Q00731
Chromosome Location : 17 C; 17 22.79 Cm
Pathway : Bladder cancer, organism-specific biosystem; Bladder cancer, conserved biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Endochondral Ossification, organism-specific biosystem; Focal Adhesion, organism-specific biosystem; Focal adhesion, organism-specific biosystem;
Function : cell surface binding; chemoattractant activity; cytokine activity; fibronectin binding; growth factor activity; heparin binding; platelet-derived growth factor receptor binding; protein heterodimerization activity; protein homodimerization activity; receptor agonist activity; vascular endothelial growth factor receptor 1 binding; vascular endothelial growth factor receptor 2 binding; vascular endothelial growth factor receptor binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.