Cat.No. :	Vegfa-18M
Product Overview :	Recombinant Mouse Vegfa(Ala27-Arg190) was expressed in Pichia pastoris.
Source :	Pichia pastoris
Species :	Mouse
Form :	Lyophilized from a 0.2 μm filtered solution of PBS，pH 7.4
Protein length :	Ala27-Arg190
AA Sequence :	APTTEGEQKSHEVIKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEAL ECVPTSESNITMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPENHCEPCSERRKHLFVQD PQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Endotoxin :	Less than 0.1 ng/µg (1 IEU/µg).
Purity :	Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Storage :	Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days.Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months.
Reconstitution :	Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in 1X PBS.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Shipping :	The product is shipped at ambient temperature.

Gene Name :	Vegfa vascular endothelial growth factor A [ Mus musculus ]
Official Symbol :	Vegfa
Synonyms :	VEGFA; vascular endothelial growth factor A; vascular permeability factor; Vpf; Vegf; Vegf120; Vegf164; Vegf188;
Gene ID :	22339
mRNA Refseq :	NM_001025250
Protein Refseq :	NP_001020421
MIM :
UniProt ID :	Q00731
Chromosome Location :	17 C; 17 22.79 Cm
Pathway :	Bladder cancer, organism-specific biosystem; Bladder cancer, conserved biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Endochondral Ossification, organism-specific biosystem; Focal Adhesion, organism-specific biosystem; Focal adhesion, organism-specific biosystem;
Function :	cell surface binding; chemoattractant activity; cytokine activity; fibronectin binding; growth factor activity; heparin binding; platelet-derived growth factor receptor binding; protein heterodimerization activity; protein homodimerization activity; receptor agonist activity; vascular endothelial growth factor receptor 1 binding; vascular endothelial growth factor receptor 2 binding; vascular endothelial growth factor receptor binding;

Online Inquiry