Recombinant Human GCLM
Cat.No. : | GCLM-27451TH |
Product Overview : | Recombinant full length Human GCLM with N terminal proprietary tag; Predicted MWt 56.25 kDa including the tag. |
- Specification
- Gene Information
- Related Products
Description : | Glutamate-cysteine ligase, also known as gamma-glutamylcysteine synthetase, is the first rate limiting enzyme of glutathione synthesis. The enzyme consists of two subunits, a heavy catalytic subunit and a light regulatory subunit. Gamma glutamylcysteine synthetase deficiency has been implicated in some forms of hemolytic anemia. |
Protein length : | 274 amino acids |
Molecular Weight : | 56.250kDa inclusive of tags |
Source : | Wheat germ |
Tissue specificity : | In all tissues examined. Highest levels in skeletal muscle. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MGTDSRAAKALLARARTLHLQTGNLLNWGRLRKKCPSTHS EELHDCIQKTLNEWSSQINPDLVREFPDVLECTVSHAVEK INPDEREEMKVSAKLFIVESNSSSSTRSAVDMACSVLGVA QLDSVIIASPPIEDGVNLSLEHLQPYWEELENLVQSKKIV AIGTSDLDKTQLEQLYQWAQVKPNSNQVNLASCCVMPPDL TAFAKQFDIQLLTHNDPKELLSGASFQEALQESIPDIQAH EWVPLWLLRYSVIVKSRGIIKSKGYILQAKRRGS |
Sequence Similarities : | Belongs to the aldo/keto reductase family. Glutamate--cysteine ligase light chain subfamily. |
Gene Name : | GCLM glutamate-cysteine ligase, modifier subunit [ Homo sapiens ] |
Official Symbol : | GCLM |
Synonyms : | GCLM; glutamate-cysteine ligase, modifier subunit; GLCLR; glutamate--cysteine ligase regulatory subunit; gamma glutamylcysteine synthetase; |
Gene ID : | 2730 |
mRNA Refseq : | NM_002061 |
Protein Refseq : | NP_002052 |
MIM : | 601176 |
Uniprot ID : | P48507 |
Chromosome Location : | 1p21 |
Pathway : | Biological oxidations, organism-specific biosystem; Glutathione biosynthesis, glutamate => glutathione, organism-specific biosystem; Glutathione biosynthesis, glutamate => glutathione, conserved biosystem; |
Function : | contributes_to glutamate-cysteine ligase activity; contributes_to glutamate-cysteine ligase activity; glutamate-cysteine ligase catalytic subunit binding; protein heterodimerization activity; |
Products Types
◆ Recombinant Protein | ||
Gclm-3175M | Recombinant Mouse Gclm Protein, Myc/DDK-tagged | +Inquiry |
GCLM-2149R | Recombinant Rat GCLM Protein, His (Fc)-Avi-tagged | +Inquiry |
GCLM-3508M | Recombinant Mouse GCLM Protein, His (Fc)-Avi-tagged | +Inquiry |
GCLM-4802H | Recombinant Human GCLM Protein, GST-tagged | +Inquiry |
GCLM-655H | Recombinant Human GCLM Protein, MYC/DDK-tagged | +Inquiry |
◆ Lysates | ||
GCLM-5982HCL | Recombinant Human GCLM 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket