Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human GHSR

Cat.No. : GHSR-29024TH
Product Overview : Recombinant full length Human Ghrelin Receptor, Isoform 1B with N terminal proprietary tag, 57.86kDa inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
Description : This gene encodes a member of the G-protein coupled receptor family. The encoded protein may play a role in energy homeostasis and regulation of body weight. Two identified transcript variants are expressed in several tissues and are evolutionary conserved in fish and swine. One transcript, 1a, excises an intron and encodes the functional protein; this protein is the receptor for the Ghrelin ligand and defines a neuroendocrine pathway for growth hormone release. The second transcript (1b) retains the intron and does not function as a receptor for Ghrelin; however, it may function to attenuate activity of isoform 1a. Mutations in this gene are associated with autosomal idiopathic short stature.
Protein length : 289 amino acids
Molecular Weight : 57.860kDa inclusive of tags
Source : Wheat germ
Tissue specificity : Pituitary and hypothalamus.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MWNATPSEEPGFNLTLADLDWDASPGNDSLGDELLQLFPA PLLAGVTATCVALFVVGIAGNLLTMLVVSRFRELRTTTNL YLSSMAFSDLLIFLCMPLDLVRLWQYRPWNFGDLLCKLFQ FVSESCTYATVLTITALSVERYFAICFPLRAKVVVTKGRV KLVIFVIWAVAFCSAGPIFVLVGVEHENGTDPWDTNECRP TEFAVRSGLLTVMVWVSSIFFFLPVFCLTVLYSLIGRKLW RRRRGDAVVGASLRDQNHKQTVKMLGGSQRALRLSLAGPI LSLCLLPSL
Sequence Similarities : Belongs to the G-protein coupled receptor 1 family.
Gene Name : GHSR growth hormone secretagogue receptor [ Homo sapiens ]
Official Symbol : GHSR
Synonyms : GHSR; growth hormone secretagogue receptor; growth hormone secretagogue receptor type 1;
Gene ID : 2693
mRNA Refseq : NM_004122
Protein Refseq : NP_004113
MIM : 601898
Uniprot ID : Q92847
Chromosome Location : 3q26.31
Pathway : Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; G alpha (q) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; GPCRs, Class A Rhodopsin-like, organism-specific biosystem;
Function : G-protein coupled receptor activity; growth hormone secretagogue receptor activity; growth hormone-releasing hormone receptor activity; peptide hormone binding; receptor activity;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends