"GNAI2" Related Products

Expand
Expand
Expand

Recombinant Human GNAI2, His-tagged

Cat.No.: GNAI2-28964TH
Product Overview: Recombinant full length protein, corresponding to amino acids 3-366 of Human G protein alpha Inhibitor 2 with N terminal His tag; 364 amino acids, 49kDa. GenBank: AAT78421.1.
Description: The protein encoded by this gene is an alpha subunit of guanine nucleotide binding proteins (G proteins). The encoded protein contains the guanine nucleotide binding site and is involved in the hormonal regulation of adenylate cyclase. Several transcript variants encoding different isoforms have been detected for this gene, but the full-length nature of only two are known so far.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 132 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Store at 4°C. Upon reconstitution store at -80oC.
Sequences of amino acids: CTVSAEDKAAAERSKMIDKNLREDGEKAAREVKLLLLGAG ESGKSTIVKQMKIIHEDGYSEEECRQYRAVVYSNTIQS IMAIVKAMGNLQIDFADPSRADDARQLFALSCTAEEQGVL PDDLSGVIRRLWADHGVQACFGRSREYQLNDSAAYYLN DLERIAQSDYIPTQQDVLRTRVKTTGIVETHFTFKDLH FKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSAYDLVLA EDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDL FEEKITHSPLTICFPEYTGANKYDEAASYIQSKFEDLN KRKDTKEIYTHFTCATDTKSRKLFRETYLKLSGPDQHPHP SPAPAPPLSSDSVP
Sequence Similarities: Belongs to the G-alpha family. G(i/o/t/z) subfamily.
Gene Name: GNAI2 guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2 [ Homo sapiens ]
Official Symbol: GNAI2
Synonyms: GNAI2; guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2; GNAI2B; guanine nucleotide-binding protein G(i) subunit alpha-2; GIP; GTP binding regulatory protein Gi alpha 2 chain;
Gene ID: 2771
mRNA Refseq: NM_001166425
Protein Refseq: NP_001159897
MIM: 139360
Uniprot ID: P04899
Chromosome Location: 3p21.31
Pathway: ADP signalling through P2Y purinoceptor 12, organism-specific biosystem; Activation of GABAB receptors, organism-specific biosystem; Adenylate cyclase inhibitory pathway, organism-specific biosystem; Axon guidance, organism-specific biosystem; Axon guidance, conserved biosystem;
Function: G-protein beta/gamma-subunit complex binding; G-protein coupled receptor binding; GTP binding; GTPase activity; GTPase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.