Recombinant Human GNAI2, His-tagged
Cat.No. : | GNAI2-28964TH |
Product Overview : | Recombinant full length protein, corresponding to amino acids 3-366 of Human G protein alpha Inhibitor 2 with N terminal His tag; 364 amino acids, 49kDa. GenBank: AAT78421.1. |
- Specification
- Gene Information
- Related Products
Description : | The protein encoded by this gene is an alpha subunit of guanine nucleotide binding proteins (G proteins). The encoded protein contains the guanine nucleotide binding site and is involved in the hormonal regulation of adenylate cyclase. Several transcript variants encoding different isoforms have been detected for this gene, but the full-length nature of only two are known so far. |
Conjugation : | HIS |
Source : | E. coli |
Form : | Lyophilised:Reconstitute with 132 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Store at 4°C. Upon reconstitution store at -80oC. |
Sequences of amino acids : | CTVSAEDKAAAERSKMIDKNLREDGEKAAREVKLLLLGAG ESGKSTIVKQMKIIHEDGYSEEECRQYRAVVYSNTIQS IMAIVKAMGNLQIDFADPSRADDARQLFALSCTAEEQGVL PDDLSGVIRRLWADHGVQACFGRSREYQLNDSAAYYLN DLERIAQSDYIPTQQDVLRTRVKTTGIVETHFTFKDLH FKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSAYDLVLA EDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDL FEEKITHSPLTICFPEYTGANKYDEAASYIQSKFEDLN KRKDTKEIYTHFTCATDTKSRKLFRETYLKLSGPDQHPHP SPAPAPPLSSDSVP |
Sequence Similarities : | Belongs to the G-alpha family. G(i/o/t/z) subfamily. |
Gene Name : | GNAI2 guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2 [ Homo sapiens ] |
Official Symbol : | GNAI2 |
Synonyms : | GNAI2; guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2; GNAI2B; guanine nucleotide-binding protein G(i) subunit alpha-2; GIP; GTP binding regulatory protein Gi alpha 2 chain; |
Gene ID : | 2771 |
mRNA Refseq : | NM_001166425 |
Protein Refseq : | NP_001159897 |
MIM : | 139360 |
Uniprot ID : | P04899 |
Chromosome Location : | 3p21.31 |
Pathway : | ADP signalling through P2Y purinoceptor 12, organism-specific biosystem; Activation of GABAB receptors, organism-specific biosystem; Adenylate cyclase inhibitory pathway, organism-specific biosystem; Axon guidance, organism-specific biosystem; Axon guidance, conserved biosystem; |
Function : | G-protein beta/gamma-subunit complex binding; G-protein coupled receptor binding; GTP binding; GTPase activity; GTPase activity; |
Products Types
◆ Recombinant Protein | ||
Gnai2-3255M | Recombinant Mouse Gnai2 Protein, Myc/DDK-tagged | +Inquiry |
GNAI2-3757M | Recombinant Mouse GNAI2 Protein, His (Fc)-Avi-tagged | +Inquiry |
GNAI2-996H | Recombinant Human GNAI2 Protein, His (Fc)-Avi-tagged | +Inquiry |
GNAI2-5042H | Recombinant Human GNAI2 Protein, GST-tagged | +Inquiry |
GNAI2-2249R | Recombinant Rat GNAI2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Lysates | ||
GNAI2-5870HCL | Recombinant Human GNAI2 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket