"GUSB" Related Products

Expand
Expand
Expand

Recombinant Human GUSB

Cat.No.: GUSB-27205TH
Product Overview: Recombinant full length Human beta glucuronidase with N terminal proprietary tag, 95.41kDa.
Description: This gene encodes a hydrolase that degrades glycosaminoglycans, including heparan sulfate, dermatan sulfate, and chondroitin-4,6-sulfate. The enzyme forms a homotetramer that is localized to the lysosome. Mutations in this gene result in mucopolysaccharidosis type VII. There are many pseudogenes of this locus in the human genome.
Protein length: 630 amino acids
Molecular Weight: 95.410kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: GLQGGMLYPQESPSRECKELDGLWSFRADFSDNRRRGFEE QWYRRPLWESGPTVDMPVPSSFNDISQDWRLRHFVGWVWY EREVILPERWTQDLRTRVVLRIGSAHSYAIVWVNGVDTLE HEGGYLPFEADISNLVQVGPLPSRLRITIAINNTLTPTTL PPGTIQYLTDTSKYPKGYFVQNTYFDFFNYAGLQRSVLLY TTPTTYIDDITVTTSVEQDSGLVNYQISVKGSNLFKLEVR LLDAENKVVANGTGTQGQLKVPGVSLWWPYLMHERPAYLY SLEVQLTAQTSLGPVSDFYTLPVGIRTVAVTKSQFLINGK PFYFHGVNKHEDADIRGKGFDWPLLVKDFNLLRWLGANAF RTSHYPYAEEVMQMCDRYGIVVIDECPGVGLALPQFFNNV SLHHHMQVMEEVVRRDKNHPAVVMWSVANEPASHLESAGY YLKMVIAHTKSLDPSRPVTFVSNSNYAADKGAPYVDVICL NSYYSWYHDYGHLELIQLQLATQFENWYKKYQKPIIQSEY GAETIAGFHQDPPLMFTEEYQKSLLEQYHLGLDQKRRKYV VGELIWNFADFMTEQSPTRVLGNKKGIFTRQRQPKSAAFL LRERYWKIANETRYPHSVAKSQCLENSLFT
Sequence Similarities: Belongs to the glycosyl hydrolase 2 family.
Gene Name: GUSB glucuronidase, beta [ Homo sapiens ]
Official Symbol: GUSB
Synonyms: GUSB; glucuronidase, beta; beta-glucuronidase;
Gene ID: 2990
mRNA Refseq: NM_000181
Protein Refseq: NP_000172
MIM: 611499
Uniprot ID: P08236
Chromosome Location: 7q11.21
Pathway: Ascorbate biosynthesis, animals, glucose-1P => ascorbate, organism-specific biosystem; Ascorbate biosynthesis, animals, glucose-1P => ascorbate, conserved biosystem; Chondroitin sulfate degradation, organism-specific biosystem;
Function: beta-glucuronidase activity; cation binding; sugar binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.