"LFNG" Related Products

Expand

Recombinant Human LFNG

Cat.No.: LFNG-29854TH
Product Overview: Recombinant full length Human Lunatic Fringe, isoform 2 with N terminal proprietary tag; Predicted MW 53.24 kDa.
Description: This gene is a member of the fringe gene family which also includes radical and manic fringe genes. They all encode evolutionarily conserved glycosyltransferases that act in the Notch signaling pathway to define boundaries during embryonic development. While their genomic structure is distinct from other glycosyltransferases, fringe proteins have a fucose-specific beta-1,3-N-acetylglucosaminyltransferase activity that leads to elongation of O-linked fucose residues on Notch, which alters Notch signaling. This gene product is predicted to be a single-pass type II Golgi membrane protein but it may also be secreted and proteolytically processed like the related proteins in mouse and Drosophila (PMID: 9187150). Mutations in this gene have been associated with autosomal recessive spondylocostal dysostosis 3. Multiple transcript variants encoding different isoforms have been found for this gene.
Protein length: 250 amino acids
Molecular Weight: 53.240kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MTPGRCCLAADIQVETFIFTDGEDEALARHTGNVVITNCS AAHSRQALSCKMAVEYDRFIESGRKWFCHVDDDNYVNLRA LLRLLASYPHTRDVYVGKPSLDRPIQAMERVSENKVRPVH FWFATGGAGFCISRGLALKMSPWASGGHFMNTAERIRLPD DCTIGYIVEALLGVPLIRSGLFHSHLENLQQVPTSELHEQ VTLSYGMFENKRNAVHVKGPFSVEADPSRFRSIHCHLYPD TPWCPRTAIF
Sequence Similarities: Belongs to the glycosyltransferase 31 family.
Gene Name: LFNG LFNG O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase [ Homo sapiens ]
Official Symbol: LFNG
Synonyms: LFNG; LFNG O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase; lunatic fringe (Drosophila) homolog , lunatic fringe homolog (Drosophila); beta-1,3-N-acetylglucosaminyltransferase lunatic fringe; SCDO3;
Gene ID: 3955
mRNA Refseq: NM_001040167
Protein Refseq: NP_001035257
MIM: 602576
Uniprot ID: Q8NES3
Chromosome Location: 7p22.3
Pathway: Delta-Notch Signaling Pathway, organism-specific biosystem; Notch signaling pathway, organism-specific biosystem; Notch signaling pathway, conserved biosystem; Other types of O-glycan biosynthesis, organism-specific biosystem; Other types of O-glycan biosynthesis, conserved biosystem;
Function: O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase activity; molecular_function; transferase activity, transferring glycosyl groups;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.