"MVD" Related Products

Expand
Expand

Recombinant Human MVD, His-tagged

Cat.No.: MVD-26959TH
Product Overview: Recombinant fragment, corresponding to amino acids 25-400 of Human MVD with an N terminal His tag; MWt 55kDa ;
Description: The enzyme mevalonate pyrophosphate decarboxylase catalyzes the conversion of mevalonate pyrophosphate into isopentenyl pyrophosphate in one of the early steps in cholesterol biosynthesis. It decarboxylates and dehydrates its substrate while hydrolyzing ATP.
Conjugation: HIS
Source: E. coli
Tissue specificity: Expressed in heart, skeletal muscle, lung, liver, brain, pancreas, kidney and placenta.
Form: Lyophilised:Reconstitute with 90 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: GKRDEELVLPINSSLSVTLHQDQLKTTTTAVISKDFTEDR IWLNGREEDVGQPRLQACLREIRCLARKRRNSRDGDPL PSSLSCKVHVASVNNFPTAAGLASSAAGYACLAYTLAR VYGVESDLSEVARRGSGSACRSLYGGFVEWQMGEQADG KDSIARQVAPESHWPELRVLILVVSAEKKLTGSTVGMRASVETSPLLRFRAESVVPARMAEMARCIRERDFPSFAQLT MKDSNQFHATCLDTFPPISYLNAISWRIIHLVHRFNAH HGDTKVAYTFDAGPNAVIFTLDDTVAEFVAAVWHGFPP GSNGDTFLKGLQVRPAPLSAELQAALAMEPTPGGVKYI IVTQVGPGPQILDDPCAHLLGPDGLPKPAA
Sequence Similarities: Belongs to the diphosphomevalonate decarboxylase family.
Gene Name: MVD mevalonate (diphospho) decarboxylase [ Homo sapiens ]
Official Symbol: MVD
Synonyms: MVD; mevalonate (diphospho) decarboxylase; diphosphomevalonate decarboxylase; mevalonate pyrophosphate decarboxylase; MPD;
Gene ID: 4597
mRNA Refseq: NM_002461
Protein Refseq: NP_002452
MIM: 603236
Uniprot ID: P53602
Chromosome Location: 16q24.3
Pathway: C5 isoprenoid biosynthesis, mevalonate pathway, organism-specific biosystem; C5 isoprenoid biosynthesis, mevalonate pathway, conserved biosystem; Cholesterol Biosynthesis, organism-specific biosystem; Cholesterol biosynthesis, organism-specific biosystem; Metabolic pathways, organism-specific biosystem;
Function: ATP binding; Hsp70 protein binding; diphosphomevalonate decarboxylase activity; diphosphomevalonate decarboxylase activity; kinase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.