Recombinant Human MYOG
Cat.No. : | MYOG-30274TH |
Product Overview : | Recombinant full length Human Myogenin with N terminal proprietary tag, 50.75kDa. |
- Specification
- Gene Information
- Related Products
Description : | Myogenin is a muscle-specific transcription factor that can induce myogenesis in a variety of cell types in tissue culture. It is a member of a large family of proteins related by sequence homology, the helix-loop-helix (HLH) proteins. It is essential for the development of functional skeletal muscle. |
Protein length : | 224 amino acids |
Molecular Weight : | 50.750kDa inclusive of tags |
Source : | Wheat germ |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MELYETSPYFYQEPRFYDGENYLPVHLQGFEPPGYERTEL TLSPEAPGPLEDKGLGTPEHCPGQCLPWACKVCKRKSVSV DRRRAATLREKRRLKKVNEAFEALKRSTLLNPNQRLPKVE ILRSAIQYIERLQALLSSLNQEERDLRYRGGGGPQPGVPS ECSSHSASCSPEWGSALEFSANPGDHLLTADPTDAHNLHS LTSIVDSITVEDVSVAFPDETMPN |
Sequence Similarities : | Contains 1 basic helix-loop-helix (bHLH) domain. |
Gene Name : | MYOG myogenin (myogenic factor 4) [ Homo sapiens ] |
Official Symbol : | MYOG |
Synonyms : | MYOG; myogenin (myogenic factor 4); MYF4; myogenin; bHLHc3; |
Gene ID : | 4656 |
mRNA Refseq : | NM_002479 |
Protein Refseq : | NP_002470 |
MIM : | 159980 |
Uniprot ID : | P15173 |
Chromosome Location : | 1q31-q41 |
Pathway : | CDO in myogenesis, organism-specific biosystem; Developmental Biology, organism-specific biosystem; Hypertrophy Model, organism-specific biosystem; Id Signaling Pathway, organism-specific biosystem; Myogenesis, organism-specific biosystem; |
Function : | DNA binding; E-box binding; protein heterodimerization activity; sequence-specific DNA binding transcription factor activity; |
Products Types
◆ Recombinant Protein | ||
Myog-1810M | Recombinant Mouse Myog Protein, His&GST-tagged | +Inquiry |
MYOG-5853H | Recombinant Human MYOG Protein, GST-tagged | +Inquiry |
MYOG-5867M | Recombinant Mouse MYOG Protein, His (Fc)-Avi-tagged | +Inquiry |
MYOG-3566H | Recombinant Human MYOG Protein, His (Fc)-Avi-tagged | +Inquiry |
Myog-1513R | Recombinant Rat Myog protein, His & T7-tagged | +Inquiry |
◆ Lysates | ||
MYOG-4004HCL | Recombinant Human MYOG 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket