Recombinant Human MYOG Protein, GST-tagged
Cat.No. : | MYOG-5853H |
Product Overview : | Human MYOG full-length ORF ( AAH53899, 1 a.a. - 224 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Myogenin is a muscle-specific transcription factor that can induce myogenesis in a variety of cell types in tissue culture. It is a member of a large family of proteins related by sequence homology, the helix-loop-helix (HLH) proteins. It is essential for the development of functional skeletal muscle. [provided by RefSeq |
Molecular Mass : | 50.38 kDa |
AA Sequence : | MELYETSPYFYQEPRFYDGENYLPVHLQGFEPPGYERTELTLSPEAPGPLEDKGLGTPEHCPGQCLPWACKVCKRKSVSVDRRRAATLREKRRLKKVNEAFEALKRSTLLNPNQRLPKVEILRSAIQYIERLQALLSSLNQEERDLRYRGGGGPQPGVPSECSSHSASCSPEWGSALEFSANPGDHLLTADPTDAHNLHSLTSIVDSITVEDVSVAFPDETMPN |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MYOG myogenin (myogenic factor 4) [ Homo sapiens ] |
Official Symbol | MYOG |
Synonyms | MYOG; myogenin (myogenic factor 4); MYF4; myogenin; bHLHc3; myf-4; myogenic factor 4; Myogenic factor-4; class C basic helix-loop-helix protein 3; MYOGENIN; |
Gene ID | 4656 |
mRNA Refseq | NM_002479 |
Protein Refseq | NP_002470 |
MIM | 159980 |
UniProt ID | P15173 |
◆ Recombinant Proteins | ||
MYOG-30274TH | Recombinant Human MYOG | +Inquiry |
MYOG-288H | Recombinant Human MYOG | +Inquiry |
Myog-1513R | Recombinant Rat Myog protein, His & T7-tagged | +Inquiry |
MYOG-327HF | Recombinant Full Length Human MYOG Protein | +Inquiry |
MYOG-5758C | Recombinant Chicken MYOG | +Inquiry |
◆ Cell & Tissue Lysates | ||
MYOG-4004HCL | Recombinant Human MYOG 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MYOG Products
Required fields are marked with *
My Review for All MYOG Products
Required fields are marked with *